StarFunc result for job id Q96ST3

User Input

>input (1273 residues)
MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTP
SYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQR
LKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIM
GFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQ
PAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQ
PVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYA
QVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRP
SQNGCQIRRHPTGTTPPVKKKPKLLNLKDSSMADASKHGGGTESLFFDKVRKALRSAEAY
ENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETYPKERATE
GIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSS
KKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGT
SEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQ
NEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLA
YEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEE
EMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQ
ILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYP
AFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQV
TDLYLAENNNGATGGQLNTQNSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIE
LLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGR
EQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHE
RVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSIN
KYRVKYGTVFKAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K3H5	0.486	0.486	0.000	1274	0.981	0.980	A0A0G2K3H5.pdb.gz	A0A0G2K3H5_RAT SIN3 transcription regulator family member A OS=Rattus norvegicus OX=10116 GN=Sin3a PE=1 SV=2
2	AFDB:D3ZBP2	0.442	0.490	0.000	1129	0.867	0.978	D3ZBP2.pdb.gz	D3ZBP2_RAT SIN3 transcription regulator family member A OS=Rattus norvegicus OX=10116 GN=Sin3a PE=1 SV=2
3	AFDB:Q1LYM8	0.450	0.478	1.036E-97	1196	0.514	0.547	Q1LYM8.pdb.gz	Q1LYM8_DANRE Paired amphipathic helix protein Sin3b OS=Danio rerio OX=7955 GN=si:dkey-6n6.6 PE=1 SV=1
4	AFDB:O75182	0.444	0.482	3.488E-92	1162	0.481	0.527	O75182.pdb.gz	SIN3B_HUMAN Paired amphipathic helix protein Sin3b OS=Homo sapiens OX=9606 GN=SIN3B PE=1 SV=2
5	AFDB:A0A1D8PCC3	0.344	0.314	3.292E-55	1411	0.311	0.281	A0A1D8PCC3.pdb.gz	A0A1D8PCC3_CANAL Transcriptional regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIN3 PE=4 SV=1
6	AFDB:Q09750	0.344	0.295	1.506E-50	1522	0.285	0.239	Q09750.pdb.gz	PST1_SCHPO Paired amphipathic helix protein pst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pst1 PE=1 SV=1
7	AFDB:O74755	0.234	0.248	2.733E-44	1154	0.219	0.242	O74755.pdb.gz	PST3_SCHPO Paired amphipathic helix protein pst3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pst3 PE=1 SV=1
8	AFDB:A5JYW9	0.292	0.255	1.370E-38	1507	0.189	0.160	A5JYW9.pdb.gz	SIN3_CAEEL Paired amphipathic helix protein sin-3 OS=Caenorhabditis elegans OX=6239 GN=sin-3 PE=1 SV=1
9	AFDB:Q9H4I2	0.046	0.055	9.881E-3	956	0.089	0.118	Q9H4I2.pdb.gz	ZHX3_HUMAN Zinc fingers and homeoboxes protein 3 OS=Homo sapiens OX=9606 GN=ZHX3 PE=1 SV=3
10	AFDB:Q99941	0.037	0.058	3.130E-2	703	0.068	0.122	Q99941.pdb.gz	ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=2
11	PDB:4iapA	0.034	0.118	1.338	256	0.018	0.090	4iapA.pdb.gz
12	PDB:7lmaD	0.032	0.145	1.995	187	0.012	0.080	7lmaD.pdb.gz	Structures of telomerase at several steps of telomere repeat synthesis.
13	PDB:6p59A	0.034	0.173	2.844	157	0.005	0.038	6p59A.pdb.gz	Structural Basis for a Species-Specific Determinant of an SIV Vif Protein toward Hominid APOBEC3G Antagonism.
14	PDB:4k6nA	0.026	0.071	3.249	352	0.007	0.026	4k6nA.pdb.gz	Structure and catalytic mechanism of yeast 4-amino-4-deoxychorismate lyase
15	PDB:1dcnB	0.065	0.119	3.550	418	0.045	0.136	1dcnB.pdb.gz	Crystal structure of an inactive duck delta II crystallin mutant with bound argininosuccinate.
16	PDB:1k92A	0.036	0.085	3.550	444	0.013	0.036	1k92A.pdb.gz
17	PDB:3s26A	0.018	0.102	3.711	169	0.005	0.036	3s26A.pdb.gz
18	PDB:1ddbA	0.050	0.211	4.055	195	0.020	0.128	1ddbA.pdb.gz
19	PDB:6ojtB	0.020	0.046	4.431	481	0.004	0.010	6ojtB.pdb.gz	Identification of functionally important residues and structural features in a bacterial lignostilbene dioxygenase.
20	PDB:1mg7B	0.034	0.087	4.632	352	0.016	0.057	1mg7B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K3H5	0.0	2515	1257	0.954	0.967	A0A0G2K3H5_RAT SIN3 transcription regulator family member A OS=Rattus norvegicus OX=10116 GN=Sin3a PE=1 SV=2
2	D3ZBP2	0.0	2604	1277	0.981	0.978	D3ZBP2_RAT SIN3 transcription regulator family member A OS=Rattus norvegicus OX=10116 GN=Sin3a PE=1 SV=2
3	O75182	0.0	1164	1162	0.485	0.531	SIN3B_HUMAN Paired amphipathic helix protein Sin3b OS=Homo sapiens OX=9606 GN=SIN3B PE=1 SV=2
4	Q1LYM8	0.0	1249	1196	0.517	0.550	Q1LYM8_DANRE Paired amphipathic helix protein Sin3b OS=Danio rerio OX=7955 GN=si:dkey-6n6.6 PE=1 SV=1
5	Q60520	0.0	2612	1274	0.981	0.980	SIN3A_MOUSE Paired amphipathic helix protein Sin3a OS=Mus musculus OX=10090 GN=Sin3a PE=1 SV=3
6	Q62141	0.0	1071	1098	0.420	0.487	SIN3B_MOUSE Paired amphipathic helix protein Sin3b OS=Mus musculus OX=10090 GN=Sin3b PE=1 SV=2
7	Q96ST3	0.0	2657	1273	1.000	1.000	SIN3A_HUMAN Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2
8	A0A0B4LF93	7.12e-151	499	1747	0.212	0.155	A0A0B4LF93_DROME Sin3A, isoform I OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
9	A1Z928	7.89e-151	499	1751	0.212	0.154	A1Z928_DROME Sin3A, isoform D OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
10	A1Z927	8.14e-151	500	1776	0.212	0.152	A1Z927_DROME Sin3A, isoform A OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
11	O17142	1.11e-150	499	1773	0.212	0.152	O17142_DROME Transcriptional co-repressor SIN3A OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=2 SV=1
12	O17143	1.20e-150	499	1751	0.212	0.154	O17143_DROME Transcriptional co-repressor SIN3A OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=2 SV=1
13	A0A126GUN9	1.23e-150	499	1786	0.212	0.151	A0A126GUN9_DROME Sin3A, isoform J OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
14	Q5U0Y0	2.00e-149	499	2062	0.212	0.131	Q5U0Y0_DROME LD13852p OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
15	O77025	3.51e-148	496	2061	0.211	0.130	O77025_DROME Transcription factor OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=2 SV=1
16	A0A0B4K765	1.94e-147	494	2066	0.212	0.131	A0A0B4K765_DROME Sin3A, isoform G OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
17	A0A0B4LF82	3.56e-146	490	2060	0.211	0.130	A0A0B4LF82_DROME Sin3A, isoform H OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
18	H3BP90	5.15e-117	363	176	0.138	1.000	H3BP90_HUMAN SIN3 transcription regulator family member A OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=1
19	Q09750	7.36e-113	389	1522	0.202	0.169	PST1_SCHPO Paired amphipathic helix protein pst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pst1 PE=1 SV=1
20	A0A1D8PCC3	7.07e-105	365	1411	0.240	0.216	A0A1D8PCC3_CANAL Transcriptional regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIN3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02671 PAH	9.4e-46	165.0	Paired amphipathic helix repeat
2	PF16879 Sin3a_C	4.7e-93	323.6	C-terminal domain of Sin3a protein
3	PF08295 Sin3_corepress	8.2e-37	136.5	Sin3 family co-repressor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378402

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268712	0.999	Nuclear receptor corepressor 1
2	9606.ENSP00000296504	0.999	Histone deacetylase complex subunit SAP30
3	9606.ENSP00000329933	0.999	PHD finger protein 12
4	9606.ENSP00000362592	0.999	Histone-binding protein RBBP4
5	9606.ENSP00000362649	0.999	Histone deacetylase 1
6	9606.ENSP00000384018	0.999	Nuclear receptor corepressor 2
7	9606.ENSP00000395535	0.999	Methyl-CpG-binding protein 2
8	9606.ENSP00000430432	0.999	Histone deacetylase 2
9	9606.ENSP00000443988	0.999	Sin3 histone deacetylase corepressor complex component SDS3
10	9606.ENSP00000262241	0.998	REST corepressor 1
11	9606.ENSP00000264444	0.998	Max dimerization protein 1
12	9606.ENSP00000307183	0.998	Inhibitor of growth protein 2
13	9606.ENSP00000369424	0.998	Histone-binding protein RBBP7
14	9606.ENSP00000481842	0.998	Histone deacetylase complex subunit SAP18
15	9606.ENSP00000364929	0.997	Inhibitor of growth protein 1
16	9606.ENSP00000396052	0.996	Breast cancer metastasis-suppressor 1
17	9606.ENSP00000264183	0.995	AT-rich interactive domain-containing protein 4B
18	9606.ENSP00000307023	0.995	Krueppel-like factor 11
19	9606.ENSP00000297109	0.994	Histone deacetylase complex subunit SAP30L
20	9606.ENSP00000331310	0.994	Mortality factor 4-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.997	RNA binding
GO:0044877	0.996	protein-containing complex binding
GO:0003682	0.908	chromatin binding
GO:0140110	0.649	transcription regulator activity
GO:0003677	0.435	DNA binding
GO:0046983	0.347	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.998	regulation of gene expression
GO:2001141	0.997	regulation of RNA biosynthetic process
GO:0006355	0.993	regulation of DNA-templated transcription
GO:0009987	0.992	cellular process
GO:0048519	0.964	negative regulation of biological process
GO:0050896	0.962	response to stimulus
GO:0048523	0.948	negative regulation of cellular process
GO:0006357	0.941	regulation of transcription by RNA polymerase II
GO:0051716	0.937	cellular response to stimulus
GO:0009892	0.875	negative regulation of metabolic process
GO:0048518	0.845	positive regulation of biological process
GO:0010605	0.826	negative regulation of macromolecule metabolic process
GO:0048522	0.790	positive regulation of cellular process
GO:0032502	0.778	developmental process
GO:0042221	0.772	response to chemical
GO:0031324	0.771	negative regulation of cellular metabolic process
GO:0031327	0.761	negative regulation of cellular biosynthetic process
GO:0045892	0.751	negative regulation of DNA-templated transcription
GO:0010604	0.721	positive regulation of macromolecule metabolic process
GO:0070887	0.668	cellular response to chemical stimulus
GO:0010033	0.617	response to organic substance
GO:0071704	0.593	organic substance metabolic process
GO:0051173	0.593	positive regulation of nitrogen compound metabolic process
GO:1901700	0.549	response to oxygen-containing compound
GO:0006950	0.535	response to stress
GO:0031325	0.530	positive regulation of cellular metabolic process
GO:0044238	0.517	primary metabolic process
GO:0006807	0.484	nitrogen compound metabolic process
GO:0043170	0.466	macromolecule metabolic process
GO:0009891	0.455	positive regulation of biosynthetic process
GO:0045935	0.452	positive regulation of nucleobase-containing compound metabolic process
GO:1902680	0.426	positive regulation of RNA biosynthetic process
GO:0044237	0.420	cellular metabolic process
GO:0045893	0.420	positive regulation of DNA-templated transcription
GO:0071310	0.416	cellular response to organic substance
GO:1901701	0.410	cellular response to oxygen-containing compound
GO:0065008	0.395	regulation of biological quality
GO:1901698	0.358	response to nitrogen compound
GO:0033554	0.329	cellular response to stress
GO:0071867	0.320	response to monoamine
GO:0000122	0.317	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0000785	0.999	chromatin
GO:0140513	0.833	nuclear protein-containing complex
GO:1902494	0.799	catalytic complex
GO:0005737	0.700	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]