StarFunc result for job id Q96SZ6

User Input

>input (601 residues)
MHPLQCVLQVQRSLGWGPLASVSWLSLRMCRAHSSLSSTMCPSPERQEDGARKDFSSRLA
AGPTFQHFLKSASAPQEKLSSEVEDPPPYLMMDELLGRQRKVYLETYGCQMNVNDTEIAW
SILQKSGYLRTSNLQEADVILLVTCSIREKAEQTIWNRLHQLKALKTRRPRSRVPLRIGI
LGCMAERLKEEILNREKMVDILAGPDAYRDLPRLLAVAESGQQAANVLLSLDETYADVMP
VQTSASATSAFVSIMRGCDNMCSYCIVPFTRGRERSRPIASILEEVKKLSEQVFLPPRPP
KVLGLQGLKEVTLLGQNVNSFRDNSEVQFNSAVPTNLSRGFTTNYKTKQGGLRFAHLLDQ
VSRVDPEMRIRFTSPHPKDFPDEVLQLIHERDNICKQIHLPAQSGSSRVLEAMRRGYSRE
AYVELVHHIRESIPGVSLSSDFIAGFCGETEEDHVQTVSLLREVQYNMGFLFAYSMRQKT
RAYHRLKDDVPEEVKLRRLEELITIFREEATKANQTSVGCTQLVLVEGLSKRSATDLCGR
NDGNLKVIFPDAEMEDVNNPGLRVRAQPGDYVLVKITSASSQTLRGHVLCRTTLRDSSAY
C

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BTW8	0.882	0.901	0.000	588	0.857	0.876	Q8BTW8.pdb.gz	CK5P1_MOUSE Mitochondrial tRNA methylthiotransferase CDK5RAP1 OS=Mus musculus OX=10090 GN=Cdk5rap1 PE=1 SV=2
2	AFDB:Q96SZ6	1.000	1.000	0.000	601	1.000	1.000	Q96SZ6.pdb.gz	CK5P1_HUMAN Mitochondrial tRNA methylthiotransferase CDK5RAP1 OS=Homo sapiens OX=9606 GN=CDK5RAP1 PE=1 SV=2
3	AFDB:O31778	0.706	0.831	1.759E-49	509	0.311	0.367	O31778.pdb.gz	MIAB_BACSU tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=miaB PE=1 SV=1
4	AFDB:P0AEI1	0.683	0.860	2.074E-46	474	0.290	0.367	P0AEI1.pdb.gz	MIAB_ECOLI tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase OS=Escherichia coli (strain K12) OX=83333 GN=miaB PE=1 SV=1
5	AFDB:P54462	0.671	0.887	3.290E-39	451	0.208	0.277	P54462.pdb.gz	MTAB_BACSU Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB OS=Bacillus subtilis (strain 168) OX=224308 GN=mtaB PE=1 SV=1
6	AFDB:Q6PG34	0.656	0.718	9.405E-35	547	0.195	0.214	Q6PG34.pdb.gz	CDKAL_DANRE Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Danio rerio OX=7955 GN=cdkal1 PE=2 SV=1
7	AFDB:Q9C7H2	0.654	0.654	1.056E-34	601	0.188	0.188	Q9C7H2.pdb.gz	Q9C7H2_ARATH Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Arabidopsis thaliana OX=3702 GN=At1g72090 PE=1 SV=1
8	AFDB:P0AEI4	0.628	0.845	1.119E-34	441	0.191	0.261	P0AEI4.pdb.gz	RIMO_ECOLI Ribosomal protein uS12 methylthiotransferase RimO OS=Escherichia coli (strain K12) OX=83333 GN=rimO PE=1 SV=1
9	AFDB:Q5VV42	0.649	0.673	1.637E-32	579	0.210	0.218	Q5VV42.pdb.gz	CDKAL_HUMAN Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Homo sapiens OX=9606 GN=CDKAL1 PE=1 SV=1
10	AFDB:Q584Z1	0.649	0.726	7.390E-32	535	0.183	0.206	Q584Z1.pdb.gz	Q584Z1_TRYB2 Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.2N9.220 PE=3 SV=1
11	PDB:3t7vA	0.273	0.449	6.044E-7	337	0.058	0.104	3t7vA.pdb.gz	Crystal structure of methylornithine synthase (PylB): insights into the pyrrolysine biosynthesis.
12	PDB:6iadA	0.234	0.311	1.406E-4	428	0.072	0.100	6iadA.pdb.gz
13	PDB:7qbuA	0.273	0.377	2.660E-4	418	0.057	0.081	7qbuA.pdb.gz	Crystallographic snapshots of a B 12 -dependent radical SAM methyltransferase.
14	PDB:5hr7A	0.236	0.357	3.165E-4	360	0.047	0.078	5hr7A.pdb.gz	Crystallographic capture of a radical S-adenosylmethionine enzyme in the act of modifying tRNA.
15	PDB:6qk7C	0.281	0.361	3.766E-4	444	0.080	0.108	6qk7C.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
16	PDB:3odmC	0.185	0.204	3.036E-3	530	0.077	0.087	3odmC.pdb.gz	Structure of an archaeal-type phosphoenolpyruvate carboxylase sensitive to inhibition by aspartate.
17	PDB:6nn8D	0.137	0.174	4.827E-3	421	0.092	0.131	6nn8D.pdb.gz
18	PDB:6v74C	0.183	0.211	6.087E-3	499	0.068	0.082	6v74C.pdb.gz	Biochemical and structural insights into how amino acids regulate pyruvate kinase muscle isoform 2.
19	PDB:3vnlA	0.190	0.319	8.619E-3	291	0.057	0.117	3vnlA.pdb.gz	Crystal structures of D-psicose 3-epimerase from Clostridium cellulolyticum H10 and its complex with ketohexose sugars.
20	PDB:6tqnA	0.111	0.130	1.026E-2	495	0.023	0.028	6tqnA.pdb.gz	Structure-Based Mechanisms of a Molecular RNA Polymerase/Chaperone Machine Required for Ribosome Biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BTW8	0.0	1061	588	0.857	0.876	CK5P1_MOUSE Mitochondrial tRNA methylthiotransferase CDK5RAP1 OS=Mus musculus OX=10090 GN=Cdk5rap1 PE=1 SV=2
2	Q96SZ6	0.0	1244	601	1.000	1.000	CK5P1_HUMAN Mitochondrial tRNA methylthiotransferase CDK5RAP1 OS=Homo sapiens OX=9606 GN=CDK5RAP1 PE=1 SV=2
3	Q9JLH6	0.0	1031	586	0.842	0.863	CK5P1_RAT Mitochondrial tRNA methylthiotransferase CDK5RAP1 OS=Rattus norvegicus OX=10116 GN=Cdk5rap1 PE=1 SV=1
4	O31778	6.16e-92	294	509	0.301	0.356	MIAB_BACSU tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=miaB PE=1 SV=1
5	P0AEI1	8.82e-88	282	474	0.298	0.378	MIAB_ECOLI tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase OS=Escherichia coli (strain K12) OX=83333 GN=miaB PE=1 SV=1
6	P54462	1.25e-44	166	451	0.215	0.286	MTAB_BACSU Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB OS=Bacillus subtilis (strain 168) OX=224308 GN=mtaB PE=1 SV=1
7	P0AEI4	1.70e-32	132	441	0.205	0.279	RIMO_ECOLI Ribosomal protein uS12 methylthiotransferase RimO OS=Escherichia coli (strain K12) OX=83333 GN=rimO PE=1 SV=1
8	Q7K4W1	5.43e-28	120	552	0.226	0.246	CDKAL_DROME Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Drosophila melanogaster OX=7227 GN=CG6550 PE=2 SV=1
9	Q5VV42	2.83e-27	118	579	0.198	0.206	CDKAL_HUMAN Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Homo sapiens OX=9606 GN=CDKAL1 PE=1 SV=1
10	Q6PG34	8.88e-27	117	547	0.183	0.201	CDKAL_DANRE Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Danio rerio OX=7955 GN=cdkal1 PE=2 SV=1
11	Q91WE6	4.99e-24	108	578	0.176	0.183	CDKAL_MOUSE Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Mus musculus OX=10090 GN=Cdkal1 PE=1 SV=1
12	Q9C7H2	6.24e-22	102	601	0.160	0.160	Q9C7H2_ARATH Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Arabidopsis thaliana OX=3702 GN=At1g72090 PE=1 SV=1
13	Q584Z1	5.31e-21	99.0	535	0.183	0.206	Q584Z1_TRYB2 Threonylcarbamoyladenosine tRNA methylthiotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.2N9.220 PE=3 SV=1
14	Q9WY26	5.87e-08	57.8	397	0.101	0.154	Q9WY26_THEMA Radical SAM core domain-containing protein OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=TM_0182 PE=1 SV=1
15	Q9BUA6	0.21	36.2	226	0.033	0.088	MYL10_HUMAN Myosin regulatory light chain 10 OS=Homo sapiens OX=9606 GN=MYL10 PE=1 SV=2
16	Q6RI86	2.8	33.5	1125	0.035	0.019	TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Trpa1 PE=2 SV=1
17	O00748	3.6	33.1	559	0.037	0.039	EST2_HUMAN Cocaine esterase OS=Homo sapiens OX=9606 GN=CES2 PE=1 SV=1
18	Q6IPK9	3.7	33.1	586	0.037	0.038	Q6IPK9_HUMAN Carboxylic ester hydrolase (Fragment) OS=Homo sapiens OX=9606 GN=CES2 PE=2 SV=1
19	Q564Q1	6.9	32.0	349	0.032	0.054	GALE_CAEEL UDP-glucose 4-epimerase OS=Caenorhabditis elegans OX=6239 GN=gale-1 PE=1 SV=1
20	Q9I969	7.4	32.0	676	0.053	0.047	TXLNB_CHICK Beta-taxilin OS=Gallus gallus OX=9031 GN=TXLNB PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04055 Radical_SAM	3.3e-23	94.4	Radical SAM superfamily
2	PF01938 TRAM	8.8e-09	46.6	TRAM domain
3	PF00919 UPF0004	4.1e-27	105.4	Uncharacterized protein family UPF0004

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217372

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419782	0.783	Cyclin-dependent-like kinase 5
2	9606.ENSP00000318486	0.779	Cyclin-dependent kinase 5 activator 1
3	9606.ENSP00000321810	0.726	tRNA dimethylallyltransferase
4	9606.ENSP00000323046	0.724	Exosome complex component RRP40
5	9606.ENSP00000170150	0.714	BPI fold containing family B member 2
6	9606.ENSP00000358909	0.698	Sideroflexin-2
7	9606.ENSP00000375978	0.683	X-ray repair cross-complementing protein 5
8	9606.ENSP00000263857	0.669	DNA-directed RNA polymerase I subunit RPA1
9	9606.ENSP00000290846	0.665	Mitochondrial tRNA-specific 2-thiouridylase 1
10	9606.ENSP00000417138	0.653	Phospholipid transfer protein
11	9606.ENSP00000352645	0.652	S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase
12	9606.ENSP00000362135	0.652	YrdC domain-containing protein, mitochondrial
13	9606.ENSP00000261249	0.633	tRNA (guanine(37)-N1)-methyltransferase
14	9606.ENSP00000302801	0.630	tRNA (adenine(58)-N(1))-methyltransferase, mitochondrial
15	9606.ENSP00000420682	0.625	Queuine tRNA-ribosyltransferase accessory subunit 2
16	9606.ENSP00000460236	0.616	Spondin-1
17	9606.ENSP00000351644	0.613	tRNA modification GTPase GTPBP3, mitochondrial
18	9606.ENSP00000383938	0.602	Cysteine rich with EGF like domains 2
19	9606.ENSP00000362873	0.593	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
20	9606.ENSP00000480186	0.593	DNA polymerase delta subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016782	1.000	transferase activity, transferring sulphur-containing groups
GO:0005488	0.998	binding
GO:0035596	0.994	methylthiotransferase activity
GO:0035597	0.943	N6-isopentenyladenosine methylthiotransferase activity
GO:0044877	0.862	protein-containing complex binding
GO:0005515	0.441	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051246	0.991	regulation of protein metabolic process
GO:0031323	0.980	regulation of cellular metabolic process
GO:0009987	0.864	cellular process
GO:0051174	0.859	regulation of phosphorus metabolic process
GO:0008152	0.840	metabolic process
GO:0071704	0.820	organic substance metabolic process
GO:0045859	0.806	regulation of protein kinase activity
GO:0006807	0.790	nitrogen compound metabolic process
GO:0044238	0.782	primary metabolic process
GO:0044237	0.774	cellular metabolic process
GO:0071900	0.741	regulation of protein serine/threonine kinase activity
GO:0043170	0.733	macromolecule metabolic process
GO:0051726	0.730	regulation of cell cycle
GO:1904029	0.719	regulation of cyclin-dependent protein kinase activity
GO:0000079	0.653	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:1901360	0.578	organic cyclic compound metabolic process
GO:0046483	0.578	heterocycle metabolic process
GO:0034641	0.578	cellular nitrogen compound metabolic process
GO:0090304	0.524	nucleic acid metabolic process
GO:0048518	0.480	positive regulation of biological process
GO:0048522	0.423	positive regulation of cellular process
GO:0016070	0.416	RNA metabolic process
GO:0010467	0.407	gene expression
GO:0043412	0.399	macromolecule modification
GO:0006396	0.395	RNA processing
GO:0009451	0.387	RNA modification
GO:0006399	0.384	tRNA metabolic process
GO:0034470	0.365	ncRNA processing
GO:0009893	0.324	positive regulation of metabolic process
GO:0008033	0.319	tRNA processing
GO:0010604	0.306	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.618	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.8.-.-	1.000	Transferring sulfur-containing groups.
EC:2.8.4.-	0.994	Transferring alkylthio groups.

[back to server]