StarFunc result for job id Q96T21

User Input

>input (854 residues)
MASEGPREPESEGIKLSADVKPFVPRFAGLNVAWLESSEACVFPSSAATYYPFVQEPPVT
EQKIYTEDMAFGASTFPPQYLSSEITLHPYAYSPYTLDSTQNVYSVPGSQYLYNQPSCYR
GFQTVKHRNENTCPLPQEMKALFKKKTYDEKKTYDQQKFDSERADGTISSEIKSARGSHH
LSIYAENSLKSDGYHKRTDRKSRIIAKNVSTSKPEFEFTTLDFPELQGAENNMSEIQKQP
KWGPVHSVSTDISLLREVVKPAAVLSKGEIVVKNNPNESVTANAATNSPSCTRELSWTPM
GYVVRQTLSTELSAAPKNVTSMINLKTIASSADPKNVSIPSSEALSSDPSYNKEKHIIHP
TQKSKASQGSDLEQNEASRKNKKKKEKSTSKYEVLTVQEPPRIEDAEEFPNLAVASERRD
RIETPKFQSKQQPQDNFKNNVKKSQLPVQLDLGGMLTALEKKQHSQHAKQSSKPVVVSVG
AVPVLSKECASGERGRRMSQMKTPHNPLDSSAPLMKKGKQREIPKAKKPTSLKKIILKER
QERKQRLQENAVSPAFTSDDTQDGESGGDDQFPEQAELSGPEGMDELISTPSVEDKSEEP
PGTELQRDTEASHLAPNHTTFPKIHSRRFRDYCSQMLSKEVDACVTDLLKELVRFQDRMY
QKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACE
QNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAYKTMLENV
QQELVGEPRPQAPPSLPTQGPSCPAEDGPPALKEKEEPHYIEIWKKHLEAYSGCTLELEE
SLEASTSQMMNLNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96T21	1.000	1.000	0.000	854	1.000	1.000	Q96T21.pdb.gz	SEBP2_HUMAN Selenocysteine insertion sequence-binding protein 2 OS=Homo sapiens OX=9606 GN=SECISBP2 PE=1 SV=2
2	AFDB:Q3TGQ4	0.301	0.300	3.667E-87	858	0.721	0.718	Q3TGQ4.pdb.gz	Q3TGQ4_MOUSE Ribosomal protein eL8/eL30/eS12/Gadd45 domain-containing protein OS=Mus musculus OX=10090 GN=Secisbp2 PE=2 SV=1
3	AFDB:Q93073	0.250	0.199	1.673E-36	1101	0.297	0.231	Q93073.pdb.gz	SBP2L_HUMAN Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens OX=9606 GN=SECISBP2L PE=1 SV=3
4	PDB:7zjwB	0.178	0.728	5.531E-24	204	0.230	0.961	7zjwB.pdb.gz	Structure of the mammalian ribosome as it decodes the selenocysteine UGA codon.
5	PDB:2aleA	0.132	0.759	6.892E-8	132	0.033	0.212	2aleA.pdb.gz	Analysis of pre-mRNA and pre-rRNA processing factor Snu13p structure and mutants.
6	PDB:4v6wCG	0.139	0.422	7.804E-8	241	0.028	0.100	4v6wCG.pdb.gz	Structures of the human and Drosophila 80S ribosome.
7	PDB:5y7mA	0.134	0.820	3.462E-7	125	0.025	0.168	5y7mA.pdb.gz	Crystal structures of the archaeal RNase P protein Rpp38 in complex with RNA fragments containing a K-turn motif.
8	PDB:3sivA	0.110	0.646	3.920E-7	128	0.027	0.180	3sivA.pdb.gz	Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
9	PDB:1xbiA	0.129	0.838	5.025E-7	118	0.027	0.195	1xbiA.pdb.gz
10	PDB:7v9aI	0.132	0.768	1.444E-6	134	0.020	0.127	7v9aI.pdb.gz	Zipper head mechanism of telomere synthesis by human telomerase.
11	PDB:4v6xCG	0.134	0.404	3.898E-6	246	0.032	0.110	4v6xCG.pdb.gz	Structures of the human and Drosophila 80S ribosome.
12	PDB:7azyb	0.131	0.417	5.657E-6	233	0.028	0.103	7azyb.pdb.gz	Context-specific action of macrolide antibiotics on the eukaryotic ribosome.
13	PDB:6faiM	0.124	0.757	8.210E-6	125	0.027	0.184	6faiM.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
14	AFDB:P34333	0.065	0.037	1.166E-5	1778	0.124	0.060	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
15	AFDB:P53882	0.039	0.051	4.244E-3	636	0.105	0.142	P53882.pdb.gz	TDA7_YEAST Topoisomerase I damage affected protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TDA7 PE=1 SV=2
16	AFDB:Q54RP6	0.070	0.041	4.516E-3	1709	0.101	0.050	Q54RP6.pdb.gz	DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum OX=44689 GN=dhkL PE=3 SV=1
17	AFDB:P29617	0.047	0.031	5.441E-3	1703	0.151	0.076	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
18	AFDB:Q86SQ0	0.061	0.046	5.789E-3	1253	0.156	0.106	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
19	AFDB:A0A1D8PGE6	0.041	0.041	6.160E-3	838	0.125	0.128	A0A1D8PGE6.pdb.gz	A0A1D8PGE6_CANAL Hap42p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HAP42 PE=4 SV=1
20	AFDB:Q0DRX6	0.069	0.068	1.012E-2	902	0.155	0.146	Q0DRX6.pdb.gz	CWZF3_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TGQ4	0.0	1125	858	0.724	0.720	Q3TGQ4_MOUSE Ribosomal protein eL8/eL30/eS12/Gadd45 domain-containing protein OS=Mus musculus OX=10090 GN=Secisbp2 PE=2 SV=1
2	Q3U1C4	0.0	1134	858	0.726	0.723	Q3U1C4_MOUSE SECIS binding protein 2 OS=Mus musculus OX=10090 GN=Secisbp2 PE=1 SV=1
3	Q96T21	0.0	1769	854	1.000	1.000	SEBP2_HUMAN Selenocysteine insertion sequence-binding protein 2 OS=Homo sapiens OX=9606 GN=SECISBP2 PE=1 SV=2
4	Q9H948	0.0	832	400	0.468	1.000	Q9H948_HUMAN cDNA FLJ13016 fis, clone NT2RP3000624, moderately similar to Rattus norvegicus SECIS binding protein 2 (sbp2 gene) OS=Homo sapiens OX=9606 PE=2 SV=1
5	Q9QX72	0.0	1150	846	0.722	0.729	SEBP2_RAT Selenocysteine insertion sequence-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Secisbp2 PE=1 SV=1
6	Q8BYU9	7.94e-153	456	414	0.266	0.548	Q8BYU9_MOUSE SECIS binding protein 2 OS=Mus musculus OX=10090 GN=Secisbp2 PE=1 SV=1
7	Q93073	3.63e-88	305	1101	0.200	0.155	SBP2L_HUMAN Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens OX=9606 GN=SECISBP2L PE=1 SV=3
8	Q9VSH1	6.13e-25	108	313	0.068	0.185	Q9VSH1_DROME GH01354p OS=Drosophila melanogaster OX=7227 GN=Sbp2 PE=2 SV=2
9	P39990	0.24	35.4	126	0.033	0.222	SNU13_YEAST 13 kDa ribonucleoprotein-associated protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNU13 PE=1 SV=1
10	Q7ZV23	2.2	32.7	128	0.020	0.133	Q7ZV23_DANRE Ribonucloprotein OS=Danio rerio OX=7955 GN=nhp2l1 PE=1 SV=1
11	Q9U3Z7	2.6	32.3	127	0.015	0.102	NH2L1_DROME NHP2-like protein 1 homolog OS=Drosophila melanogaster OX=7227 GN=hoip PE=2 SV=1
12	P55769	3.2	32.0	128	0.020	0.133	NH2L1_HUMAN NHP2-like protein 1 OS=Homo sapiens OX=9606 GN=SNU13 PE=1 SV=3
13	Q9D0T1	3.2	32.0	128	0.020	0.133	NH2L1_MOUSE NHP2-like protein 1 OS=Mus musculus OX=10090 GN=Snu13 PE=1 SV=4
14	Q7KB18	3.6	33.5	463	0.018	0.032	Q7KB18_DROME Epoxide hydrolase OS=Drosophila melanogaster OX=7227 GN=Jheh2 PE=1 SV=1
15	Q9BL45	4.4	33.1	360	0.032	0.075	Q9BL45_CAEEL Cyclin N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cosa-1 PE=4 SV=3
16	Q57612	8.1	32.3	336	0.018	0.045	TRUB_METJA Probable tRNA pseudouridine synthase B OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=truB PE=1 SV=1
17	Q9P7H0	9.6	31.2	154	0.026	0.143	NHP2_SCHPO H/ACA ribonucleoprotein complex subunit nhp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nhp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01248 Ribosomal_L7Ae	2.3e-18	77.0	Ribosomal protein L7Ae/L30e/S12e/Gadd45 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364965

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254730	0.995	Selenocysteine-specific elongation factor
2	9606.ENSP00000362936	0.907	tRNA selenocysteine 1-associated protein 1
3	9606.ENSP00000357882	0.870	L-seryl-tRNA(Sec) kinase
4	9606.ENSP00000368459	0.838	Nuclear fragile X mental retardation-interacting protein 1
5	9606.ENSP00000371535	0.826	O-phosphoseryl-tRNA(Sec) selenium transferase
6	9606.ENSP00000450980	0.823	Responsible for the deiodination of T4 (3,5,3',5'- tetraiodothyronine)
7	9606.ENSP00000418669	0.816	Selenide, water dikinase 2
8	9606.ENSP00000381282	0.806	Selenoprotein S
9	9606.ENSP00000355141	0.793	Selenoprotein N
10	9606.ENSP00000428085	0.787	Ribosomal protein L30
11	9606.ENSP00000420939	0.774	Selenoprotein P
12	9606.ENSP00000418813	0.769	Required for Ca(2+) flux in immune cells and plays a role in T-cell proliferation and in T-cell and neutrophil migration (By similarity). Involved in endoplasmic reticulum-associated degradation (ERAD) of soluble glycosylated proteins . Required for palmitoylation and cell surface expression of CD36 and involved in macrophage uptake of low-density lipoprotein and in foam cell formation (By similarity). Together with ZDHHC6, required for palmitoylation of ITPR1 in immune cells, leading to regulate ITPR1 stability and function . Plays a role in protection of cells from ER stress- induced [...]
13	9606.ENSP00000367893	0.762	Selenide, water dikinase 1
14	9606.ENSP00000234677	0.755	Serine--tRNA ligase, cytoplasmic
15	9606.ENSP00000346103	0.753	Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
16	9606.ENSP00000328729	0.749	May be involved in redox reactions associated with the formation of disulfide bonds (By similarity). May contribute to the quality control of protein folding in the endoplasmic reticulum . May regulate protein folding by enhancing the catalytic activity of UGGT1/UGCGL1 and UGGT2/UGCGL2 .
17	9606.ENSP00000418910	0.749	Selenoprotein with thioredoxin reductase-like oxidoreductase activity (By similarity). Protects dopaminergic neurons against oxidative stress ans cell death . Involved in ADCYAP1/PACAP-induced calcium mobilization and neuroendocrine secretion (By similarity). Plays a role in fibroblast anchorage and redox regulation (By similarity). In gastric smooth muscle, modulates the contraction processes through the regulation of calcium release and MYLK activation (By similarity). In pancreatic islets, involved in the control of glucose homeostasis, contributes to prolonged ADCYAP1/PACAP- induce [...]
18	9606.ENSP00000269349	0.736	Eukaryotic initiation factor 4A-III
19	9606.ENSP00000370288	0.732	Catalyzes the transfer of adenosine 5'-monophosphate (AMP) to Ser, Thr and Tyr residues of target proteins (AMPylation) . May be a redox-active mitochondrial selenoprotein which interacts with a redox target protein .
20	9606.ENSP00000473185	0.702	Selenoprotein W

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003729	1.000	mRNA binding
GO:0003730	0.993	mRNA 3'-UTR binding
GO:0003677	0.939	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0044238	0.993	primary metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0065007	0.986	biological regulation
GO:0050789	0.977	regulation of biological process
GO:0050794	0.973	regulation of cellular process
GO:0043170	0.932	macromolecule metabolic process
GO:0019222	0.927	regulation of metabolic process
GO:0048523	0.922	negative regulation of cellular process
GO:0060255	0.921	regulation of macromolecule metabolic process
GO:0080090	0.920	regulation of primary metabolic process
GO:0051171	0.920	regulation of nitrogen compound metabolic process
GO:0031323	0.919	regulation of cellular metabolic process
GO:0019538	0.907	protein metabolic process
GO:0048518	0.906	positive regulation of biological process
GO:0010628	0.868	positive regulation of gene expression
GO:0034248	0.849	regulation of amide metabolic process
GO:0034641	0.840	cellular nitrogen compound metabolic process
GO:2000112	0.828	regulation of cellular macromolecule biosynthetic process
GO:1901576	0.812	organic substance biosynthetic process
GO:0044249	0.812	cellular biosynthetic process
GO:0019219	0.810	regulation of nucleobase-containing compound metabolic process
GO:0010608	0.802	post-transcriptional regulation of gene expression
GO:0051246	0.796	regulation of protein metabolic process
GO:0006417	0.789	regulation of translation
GO:0051252	0.787	regulation of RNA metabolic process
GO:0009894	0.786	regulation of catabolic process
GO:0009059	0.778	macromolecule biosynthetic process
GO:0006412	0.767	translation
GO:0009892	0.763	negative regulation of metabolic process
GO:0006414	0.751	translational elongation
GO:0031324	0.733	negative regulation of cellular metabolic process
GO:0009895	0.658	negative regulation of catabolic process
GO:0031329	0.649	regulation of cellular catabolic process
GO:0010605	0.564	negative regulation of macromolecule metabolic process
GO:0031330	0.560	negative regulation of cellular catabolic process
GO:0032501	0.504	multicellular organismal process
GO:0051172	0.491	negative regulation of nitrogen compound metabolic process
GO:0032502	0.480	developmental process
GO:0048856	0.452	anatomical structure development
GO:0061013	0.427	regulation of mRNA catabolic process
GO:0007275	0.397	multicellular organism development
GO:0051253	0.360	negative regulation of RNA metabolic process
GO:1902369	0.331	negative regulation of RNA catabolic process
GO:1903312	0.316	negative regulation of mRNA metabolic process
GO:0048731	0.309	system development
GO:0048513	0.308	animal organ development
GO:0048468	0.308	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.996	cytoplasm
GO:0005829	0.991	cytosol
GO:0032991	0.972	protein-containing complex
GO:1990904	0.714	ribonucleoprotein complex
GO:0005739	0.709	mitochondrion
GO:0043228	0.429	non-membrane-bounded organelle
GO:0043232	0.422	intracellular non-membrane-bounded organelle
GO:0016020	0.300	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]