StarFunc result for job id Q96T37

User Input

>input (977 residues)
MRTAGRDPVPRRSPRWRRAVPLCETSAGRRVTQLRGDDLRRPATMKGKERSPVKAKRSRG
GEDSTSRGERSKKLGGSGGSNGSSSGKTDSGGGSRRSLHLDKSSSRGGSREYDTGGGSSS
SRLHSYSSPSTKNSSGGGESRSSSRGGGGESRSSGAASSAPGGGDGAEYKTLKISELGSQ
LSDEAVEDGLFHEFKRFGDVSVKISHLSGSGSGDERVAFVNFRRPEDARAAKHARGRLVL
YDRPLKIEAVYVSRRRSRSPLDKDTYPPSASVVGASVGGHRHPPGGGGGQRSLSPGGAAL
GYRDYRLQQLALGRLPPPPPPPLPRDLERERDYPFYERVRPAYSLEPRVGAGAGAAPFRE
VDEISPEDDQRANRTLFLGNLDITVTESDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLK
FENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGT
IRTIDYRKGDSWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLRVDFADTEHRYQQQYLQP
LPLTHYELVTDAFGHRAPDPLRGARDRTPPLLYRDRDRDLYPDSDWVPPPPPVRERSTRT
AATSVPAYEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRRLPEESGGRHLDRSPESD
RPRKRHCAPSPDRSPELSSSRDRYNSDNDRSSRLLLERPSPIRDRRGSLEKSQGDKRDRK
NSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASA
SPKLCLAWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQLKITQRLRLDQP
KLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSAASDTATSTQRPLRNLVSYLKQKQA
AGVISLPVGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRGFGFQI
GVRYENKKRENLALTLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96T37	1.000	1.000	0.000	977	1.000	1.000	Q96T37.pdb.gz	RBM15_HUMAN RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15 PE=1 SV=2
2	PDB:7oqcF	0.081	0.275	8.757E-10	267	0.057	0.210	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
3	AFDB:O43719	0.078	0.100	1.152E-9	755	0.087	0.113	O43719.pdb.gz	HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1
4	PDB:5vsuA	0.088	0.196	2.270E-9	387	0.056	0.142	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
5	PDB:6y53o	0.076	0.428	2.990E-8	160	0.046	0.281	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
6	PDB:6ff7X	0.076	0.398	2.378E-7	171	0.033	0.187	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
7	PDB:5lsbA	0.074	0.381	8.632E-7	176	0.037	0.205	5lsbA.pdb.gz
8	PDB:6y5qq	0.078	0.390	2.504E-6	178	0.030	0.163	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
9	PDB:6r5kH	0.080	0.187	2.801E-6	394	0.068	0.168	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
10	AFDB:A8JNQ4	0.080	0.097	5.456E-6	796	0.120	0.147	A8JNQ4.pdb.gz	A8JNQ4_DROME RNA-binding Fox protein 1, isoform I OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=4 SV=2
11	PDB:7evoD	0.081	0.368	9.610E-6	200	0.033	0.160	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
12	PDB:3lqvB	0.078	0.604	3.298E-5	115	0.017	0.148	3lqvB.pdb.gz	Branch Recognition by SF3b14
13	PDB:6qx91K	0.076	0.352	4.364E-5	201	0.038	0.184	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
14	AFDB:D3ZHK8	0.074	0.098	8.502E-5	717	0.094	0.128	D3ZHK8.pdb.gz	D3ZHK8_RAT Cytoplasmic polyadenylation element binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cpeb2 PE=1 SV=4
15	AFDB:Q8IGV1	0.079	0.079	2.331E-4	977	0.142	0.142	Q8IGV1.pdb.gz	Q8IGV1_DROME RE24907p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Saf-B PE=2 SV=1
16	AFDB:A0A140UHY3	0.083	0.121	3.451E-4	661	0.118	0.174	A0A140UHY3.pdb.gz	A0A140UHY3_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1
17	AFDB:P78332	0.071	0.063	3.861E-4	1123	0.132	0.115	P78332.pdb.gz	RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5
18	AFDB:Q6XP49	0.049	0.055	8.461E-4	780	0.137	0.172	Q6XP49.pdb.gz	GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus OX=10090 GN=Glis3 PE=1 SV=2
19	AFDB:F4KE59	0.115	0.089	1.658E-3	1311	0.148	0.111	F4KE59.pdb.gz	PAIP2_ARATH Protein PARALOG OF AIPP2 OS=Arabidopsis thaliana OX=3702 GN=PAIPP2 PE=1 SV=1
20	AFDB:A8DYK5	0.079	0.062	5.085E-3	1306	0.122	0.091	A8DYK5.pdb.gz	A8DYK5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Isha PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WWP4	0.0	1858	933	0.955	1.000	A0A087WWP4_HUMAN RNA binding motif protein 15 OS=Homo sapiens OX=9606 GN=RBM15 PE=1 SV=1
2	A0A494C001	0.0	1753	896	0.903	0.984	A0A494C001_HUMAN RNA binding motif protein 15 OS=Homo sapiens OX=9606 GN=RBM15 PE=1 SV=2
3	A0A499FJY3	0.0	1812	925	0.933	0.986	A0A499FJY3_HUMAN RNA binding motif protein 15 OS=Homo sapiens OX=9606 GN=RBM15 PE=1 SV=1
4	Q0VBL3	0.0	1591	962	0.927	0.942	RBM15_MOUSE RNA-binding protein 15 OS=Mus musculus OX=10090 GN=Rbm15 PE=1 SV=1
5	Q96T37	0.0	1946	977	1.000	1.000	RBM15_HUMAN RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15 PE=1 SV=2
6	Q6PHZ5	1.72e-179	546	887	0.396	0.436	RB15B_MOUSE Putative RNA-binding protein 15B OS=Mus musculus OX=10090 GN=Rbm15b PE=1 SV=2
7	Q8NDT2	8.04e-163	503	890	0.314	0.345	RB15B_HUMAN Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3
8	Q7KMJ6	2.43e-81	283	793	0.165	0.203	NITO_DROME RNA-binding protein spenito OS=Drosophila melanogaster OX=7227 GN=nito PE=1 SV=1
9	Q96T58	1.93e-25	117	3664	0.062	0.017	MINT_HUMAN Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1
10	Q62504	1.96e-25	117	3644	0.062	0.017	MINT_MOUSE Msx2-interacting protein OS=Mus musculus OX=10090 GN=Spen PE=1 SV=2
11	H2KYB8	1.60e-24	111	520	0.063	0.119	H2KYB8_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=grld-1 PE=1 SV=1
12	A0A669KB49	1.96e-24	112	704	0.062	0.087	A0A669KB49_HUMAN Spen family transcriptional repressor (Fragment) OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1
13	Q8SX83	2.58e-23	110	5560	0.070	0.012	SPEN_DROME Protein split ends OS=Drosophila melanogaster OX=7227 GN=spen PE=1 SV=2
14	Q8LPQ9	2.64e-16	86.7	901	0.062	0.068	FPA_ARATH Flowering time control protein FPA OS=Arabidopsis thaliana OX=3702 GN=FPA PE=1 SV=2
15	Q99383	4.14e-10	65.9	534	0.049	0.090	HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HRP1 PE=1 SV=1
16	Q8R326	1.26e-09	64.3	523	0.039	0.073	PSPC1_MOUSE Paraspeckle component 1 OS=Mus musculus OX=10090 GN=Pspc1 PE=1 SV=1
17	Q6AWW6	1.30e-09	64.3	512	0.057	0.109	Q6AWW6_ARATH At2g47310 OS=Arabidopsis thaliana OX=3702 GN=At2g47310 PE=1 SV=1
18	Q8WXF1	1.54e-09	63.9	523	0.039	0.073	PSPC1_HUMAN Paraspeckle component 1 OS=Homo sapiens OX=9606 GN=PSPC1 PE=1 SV=1
19	O64380	6.12e-09	62.4	660	0.043	0.064	PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=PAB3 PE=2 SV=1
20	Q94901	2.00e-08	59.7	352	0.037	0.102	LARK_DROME RNA-binding protein lark OS=Drosophila melanogaster OX=7227 GN=lark PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14605 Nup35_RRM_2	0.051	24.9	Nup53/35/40-type RNA recognition motif
2	PF00076 RRM_1	9.8e-22	87.9	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF08777 RRM_3	11	17.5	RNA binding motif
4	PF16367 RRM_7	6.1	18.4	RNA recognition motif
5	PF07744 SPOC	2.8e-35	132.9	SPOC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358799

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351141	0.999	Pre-mRNA-splicing regulator WTAP
2	9606.ENSP00000282007	0.998	Zinc finger CCCH domain-containing protein 13
3	9606.ENSP00000297591	0.998	Protein virilizer homolog
4	9606.ENSP00000298717	0.994	N6-adenosine-methyltransferase catalytic subunit
5	9606.ENSP00000373474	0.994	N6-adenosine-methyltransferase non-catalytic subunit
6	9606.ENSP00000401277	0.993	E3 ubiquitin-protein ligase Hakai
7	9606.ENSP00000454545	0.975	Putative RNA-binding protein 15B
8	9606.ENSP00000436679	0.891	Nuclear RNA export factor 1
9	9606.ENSP00000339245	0.853	YTH domain-containing protein 1
10	9606.ENSP00000442924	0.841	Histone-lysine N-methyltransferase SETD1B
11	9606.ENSP00000347847	0.821	MKL/myocardin-like protein 1
12	9606.ENSP00000364320	0.819	mRNA turnover protein 4 homolog
13	9606.ENSP00000268712	0.798	Nuclear receptor corepressor 1
14	9606.ENSP00000421592	0.792	THO complex subunit 4
15	9606.ENSP00000313829	0.789	KH domain-containing, RNA-binding, signal transduction-associated protein 1
16	9606.ENSP00000382091	0.764	RNA demethylase ALKBH5
17	9606.ENSP00000263092	0.761	U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase
18	9606.ENSP00000362918	0.745	YTH domain-containing family protein 2
19	9606.ENSP00000359364	0.743	YTH domain-containing family protein 1
20	9606.ENSP00000161863	0.740	Probable ATP-dependent RNA helicase YTHDC2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003729	0.998	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0010468	0.995	regulation of gene expression
GO:0080090	0.993	regulation of primary metabolic process
GO:0051171	0.993	regulation of nitrogen compound metabolic process
GO:0031323	0.993	regulation of cellular metabolic process
GO:0009987	0.989	cellular process
GO:0071704	0.983	organic substance metabolic process
GO:0051252	0.977	regulation of RNA metabolic process
GO:0043170	0.972	macromolecule metabolic process
GO:0044238	0.955	primary metabolic process
GO:0044237	0.949	cellular metabolic process
GO:0000381	0.938	regulation of alternative mRNA splicing, via spliceosome
GO:0006807	0.934	nitrogen compound metabolic process
GO:0016070	0.898	RNA metabolic process
GO:0043412	0.838	macromolecule modification
GO:0016043	0.671	cellular component organization
GO:0044260	0.634	cellular macromolecule metabolic process
GO:0048518	0.582	positive regulation of biological process
GO:0048522	0.473	positive regulation of cellular process
GO:0032259	0.472	methylation
GO:0050896	0.463	response to stimulus
GO:0043414	0.458	macromolecule methylation
GO:0045595	0.450	regulation of cell differentiation
GO:0031326	0.425	regulation of cellular biosynthetic process
GO:0051239	0.387	regulation of multicellular organismal process
GO:0009451	0.379	RNA modification
GO:0002682	0.378	regulation of immune system process
GO:0010556	0.376	regulation of macromolecule biosynthetic process
GO:0048519	0.370	negative regulation of biological process
GO:0048523	0.361	negative regulation of cellular process
GO:0001510	0.357	RNA methylation
GO:0006325	0.353	chromatin organization
GO:0010604	0.329	positive regulation of macromolecule metabolic process
GO:2000026	0.327	regulation of multicellular organismal development
GO:0060284	0.317	regulation of cell development
GO:0032502	0.314	developmental process
GO:0051173	0.314	positive regulation of nitrogen compound metabolic process
GO:0031325	0.314	positive regulation of cellular metabolic process
GO:2001141	0.305	regulation of RNA biosynthetic process
GO:0006355	0.304	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.951	protein-containing complex
GO:0036396	0.393	RNA N6-methyladenosine methyltransferase complex
GO:0005737	0.318	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]