StarFunc result for job id Q96T49

User Input

>input (567 residues)
MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGR
RKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLL
LSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTL
DVIETCMAYQGITQEKINEMRVAPEQQMIADIHCMIAAGQDLDWIDAQGATLLHIAGANG
YLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSMDEMPID
LCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSAGSRGKVVRRASLSDRTNLYRK
EYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKIPRGEL
DMPVENGLRAPVSAYQYALANGDVWKVHEVPDYSMAYGNPGVADATPPWSSYKEQSPQTL
LELKRQRAAAKLLSHPFLSTHLGSSMARTGESSSEGKAPLIGGRTSPYSSNGTSVYYTVT
SGDPPLLKFKAPIEEMEEKVHGCCRIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VHQ3	0.603	0.602	2.397E-66	568	0.965	0.963	Q8VHQ3.pdb.gz	PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus OX=10090 GN=Ppp1r16b PE=1 SV=1
2	AFDB:Q923M0	0.496	0.535	1.899E-38	524	0.469	0.508	Q923M0.pdb.gz	PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus OX=10090 GN=Ppp1r16a PE=1 SV=1
3	AFDB:Q96I34	0.550	0.587	1.428E-37	528	0.462	0.496	Q96I34.pdb.gz	PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens OX=9606 GN=PPP1R16A PE=1 SV=1
4	AFDB:Q8SY34	0.500	0.387	8.044E-31	741	0.376	0.287	Q8SY34.pdb.gz	Q8SY34_DROME LD46604p OS=Drosophila melanogaster OX=7227 GN=MYPT-75D PE=2 SV=1
5	AFDB:M9NDA1	0.393	0.198	2.987E-19	1230	0.252	0.116	M9NDA1.pdb.gz	M9NDA1_DROME Myosin binding subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
6	AFDB:M9NEB2	0.386	0.192	5.422E-19	1273	0.240	0.107	M9NEB2.pdb.gz	M9NEB2_DROME Myosin binding subunit, isoform O OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
7	AFDB:Q86R99	0.395	0.293	5.676E-19	797	0.266	0.189	Q86R99.pdb.gz	Q86R99_DROME Myosin phosphatase DMBS-S OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
8	AFDB:Q86RA0	0.394	0.258	8.576E-19	927	0.242	0.148	Q86RA0.pdb.gz	Q86RA0_DROME Myosin phosphatase DMBS-L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
9	AFDB:O60237	0.408	0.254	8.978E-19	982	0.270	0.156	O60237.pdb.gz	MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=2
10	AFDB:Q90623	0.404	0.244	1.958E-18	1004	0.257	0.145	Q90623.pdb.gz	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1
11	PDB:8cs9A	0.188	0.135	8.549E-13	796	0.125	0.089	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:2dvwA	0.204	0.484	1.017E-11	229	0.111	0.275	2dvwA.pdb.gz
13	PDB:6v9hC	0.198	0.399	4.786E-10	270	0.102	0.215	6v9hC.pdb.gz
14	PDB:1wg0A	0.197	0.436	8.298E-10	243	0.109	0.255	1wg0A.pdb.gz
15	PDB:4oauC	0.200	0.165	2.733E-9	692	0.099	0.081	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
16	PDB:5vkqA	0.202	0.079	1.963E-8	1499	0.118	0.045	5vkqA.pdb.gz
17	PDB:6mwqA	0.151	0.174	7.089E-8	493	0.092	0.105	6mwqA.pdb.gz
18	PDB:1bd8A	0.184	0.620	4.863E-7	156	0.093	0.340	1bd8A.pdb.gz
19	PDB:6jd6B	0.151	0.426	5.842E-7	192	0.074	0.219	6jd6B.pdb.gz
20	PDB:6aunA	0.168	0.154	6.404E-7	618	0.095	0.087	6aunA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VHQ3	0.0	1137	568	0.965	0.963	PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus OX=10090 GN=Ppp1r16b PE=1 SV=1
2	Q95N27	0.0	1146	568	0.970	0.968	PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus OX=9913 GN=PPP1R16B PE=1 SV=1
3	Q96T49	0.0	1180	567	1.000	1.000	PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens OX=9606 GN=PPP1R16B PE=1 SV=1
4	Q923M0	6.88e-161	471	524	0.480	0.519	PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus OX=10090 GN=Ppp1r16a PE=1 SV=1
5	Q96I34	2.94e-152	449	528	0.473	0.508	PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens OX=9606 GN=PPP1R16A PE=1 SV=1
6	M9PFV2	1.09e-103	327	635	0.326	0.291	M9PFV2_DROME Myosin phosphatase targeting subunit 75D, isoform B OS=Drosophila melanogaster OX=7227 GN=MYPT-75D PE=4 SV=1
7	Q8SY34	8.99e-103	328	741	0.326	0.250	Q8SY34_DROME LD46604p OS=Drosophila melanogaster OX=7227 GN=MYPT-75D PE=2 SV=1
8	O60237	3.96e-54	200	982	0.205	0.118	MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=2
9	M9NFZ0	2.47e-51	181	341	0.196	0.326	M9NFZ0_DROME Myosin binding subunit, isoform P OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
10	Q8BG95	6.22e-50	187	976	0.189	0.110	MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus OX=10090 GN=Ppp1r12b PE=1 SV=2
11	F8VZN8	1.70e-49	184	692	0.192	0.158	F8VZN8_HUMAN Protein phosphatase 1 regulatory subunit 12A (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1
12	Q8IQN4	1.77e-49	186	1144	0.198	0.098	Q8IQN4_DROME FI18194p1 OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=2
13	Q9VUX6	1.91e-49	185	860	0.196	0.129	Q9VUX6_DROME Myosin binding subunit, isoform K OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=3
14	M9NFF6	1.92e-49	186	1243	0.196	0.089	M9NFF6_DROME Myosin binding subunit, isoform M OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
15	Q8MT32	1.92e-49	186	1144	0.198	0.098	Q8MT32_DROME RE63915p OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
16	M9PCQ3	2.09e-49	186	1111	0.198	0.101	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
17	M9NEB2	2.16e-49	186	1273	0.196	0.087	M9NEB2_DROME Myosin binding subunit, isoform O OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
18	Q8MV37	2.27e-49	186	1101	0.198	0.102	Q8MV37_DROME Myosin binding subunit of myosin phosphatase OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
19	M9NDS8	2.30e-49	186	1245	0.196	0.089	M9NDS8_DROME Myosin binding subunit, isoform N OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
20	A8JNT5	2.34e-49	184	795	0.196	0.140	A8JNT5_DROME Myosin binding subunit, isoform G OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2e-22	89.8	Ankyrin repeat
2	PF12796 Ank_2	5.5e-27	105.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	4.3e-15	65.2	Ankyrin repeat
4	PF13637 Ank_4	2.9e-23	93.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	4.2e-21	86.0	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299824

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341779	0.946	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
2	9606.ENSP00000378769	0.923	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
3	9606.ENSP00000346067	0.858	40S ribosomal protein SA
4	9606.ENSP00000353408	0.696	Moesin
5	9606.ENSP00000234038	0.693	Protein phosphatase 1 regulatory subunit 7
6	9606.ENSP00000326031	0.629	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0003158	0.945	endothelium development
GO:0001885	0.939	endothelial cell development
GO:0019222	0.889	regulation of metabolic process
GO:0060255	0.871	regulation of macromolecule metabolic process
GO:0051171	0.844	regulation of nitrogen compound metabolic process
GO:0080090	0.843	regulation of primary metabolic process
GO:0051246	0.821	regulation of protein metabolic process
GO:0035303	0.821	regulation of dephosphorylation
GO:0048518	0.770	positive regulation of biological process
GO:0048522	0.689	positive regulation of cellular process
GO:0048583	0.676	regulation of response to stimulus
GO:0048519	0.642	negative regulation of biological process
GO:0009966	0.621	regulation of signal transduction
GO:0031399	0.620	regulation of protein modification process
GO:0010604	0.467	positive regulation of macromolecule metabolic process
GO:0051173	0.456	positive regulation of nitrogen compound metabolic process
GO:0014066	0.444	regulation of phosphatidylinositol 3-kinase signaling
GO:0050793	0.417	regulation of developmental process
GO:0051247	0.399	positive regulation of protein metabolic process
GO:0042127	0.388	regulation of cell population proliferation
GO:0050896	0.351	response to stimulus
GO:0048523	0.348	negative regulation of cellular process
GO:0035304	0.330	regulation of protein dephosphorylation
GO:0051128	0.314	regulation of cellular component organization
GO:0044087	0.305	regulation of cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0005886	0.995	plasma membrane
GO:0031981	0.990	nuclear lumen
GO:0005654	0.981	nucleoplasm
GO:0005829	0.904	cytosol
GO:0043232	0.700	intracellular non-membrane-bounded organelle
GO:0016604	0.589	nuclear body
GO:0042995	0.348	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]