StarFunc result for job id Q96T52

User Input

>input (175 residues)
MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVL
LNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRYVKVPRGHIWV
EGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPERWQKLESVLPPERLPVQREEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BPT6	0.979	0.979	1.691E-31	175	0.909	0.909	Q8BPT6.pdb.gz	IMP2L_MOUSE Mitochondrial inner membrane protease subunit 2 OS=Mus musculus OX=10090 GN=Immp2l PE=1 SV=1
2	AFDB:P46972	0.826	0.817	2.343E-16	177	0.366	0.362	P46972.pdb.gz	IMP2_YEAST Mitochondrial inner membrane protease subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMP2 PE=1 SV=1
3	AFDB:Q9UST2	0.803	0.782	1.328E-15	180	0.371	0.361	Q9UST2.pdb.gz	IMP2L_SCHPO Mitochondrial inner membrane protease subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC336.13c PE=3 SV=1
4	AFDB:Q6NLT8	0.761	0.790	1.558E-14	168	0.309	0.321	Q6NLT8.pdb.gz	IMP1A_ARATH Mitochondrial ATP-independent inner membrane protease subunit 1a OS=Arabidopsis thaliana OX=3702 GN=IMP1A PE=2 SV=1
5	AFDB:Q96LU5	0.813	0.854	8.833E-14	166	0.280	0.295	Q96LU5.pdb.gz	IMP1L_HUMAN Mitochondrial inner membrane protease subunit 1 OS=Homo sapiens OX=9606 GN=IMMP1L PE=2 SV=1
6	AFDB:O74800	0.676	0.751	1.286E-11	157	0.263	0.293	O74800.pdb.gz	IMP1_SCHPO Mitochondrial inner membrane protease subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imp1 PE=3 SV=1
7	AFDB:Q8H0W1	0.710	0.438	4.621E-10	291	0.229	0.137	Q8H0W1.pdb.gz	PLSP1_ARATH Chloroplast processing peptidase OS=Arabidopsis thaliana OX=3702 GN=PLSP1 PE=2 SV=2
8	AFDB:O04348	0.654	0.349	7.230E-10	340	0.257	0.132	O04348.pdb.gz	TPP1_ARATH Thylakoidal processing peptidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TPP1 PE=2 SV=2
9	AFDB:P28627	0.655	0.610	1.497E-9	190	0.229	0.211	P28627.pdb.gz	IMP1_YEAST Mitochondrial inner membrane protease subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMP1 PE=1 SV=3
10	AFDB:Q84VZ6	0.637	0.551	3.875E-9	205	0.177	0.151	Q84VZ6.pdb.gz	IMP2_ARATH Mitochondrial ATP-independent inner membrane protease subunit 2 OS=Arabidopsis thaliana OX=3702 GN=IMP1B PE=2 SV=1
11	PDB:4wvhA	0.531	0.189	3.986E-5	519	0.166	0.056	4wvhA.pdb.gz	Peptide binding to a bacterial signal peptidase visualized by peptide tethering and carrier-driven crystallization.
12	PDB:7p2pA	0.432	0.495	5.147E-2	148	0.154	0.182	7p2pA.pdb.gz
13	PDB:3j6bM	0.252	0.284	7.554E-1	151	0.103	0.119	3j6bM.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
14	PDB:2zaeA	0.175	0.249	7.989E-1	105	0.091	0.152	2zaeA.pdb.gz	Structure of an archaeal homolog of the human protein complex Rpp21-Rpp29 that is a key core component for the assembly of active ribonuclease P.
15	PDB:1zq1A	0.227	0.108	1.479	437	0.051	0.021	1zq1A.pdb.gz	Structural Basis for tRNA-Dependent Amidotransferase Function
16	PDB:5tbyA	0.209	0.045	1.956	954	0.086	0.016	5tbyA.pdb.gz
17	PDB:1qfjA	0.123	0.102	2.068	226	0.029	0.022	1qfjA.pdb.gz
18	PDB:3elzB	0.168	0.206	2.188	135	0.074	0.096	3elzB.pdb.gz	The X-Ray structure of zebrafish (Danio rerio) ileal bile acid-binding protein reveals the presence of binding sites on the surface of the protein molecule.
19	PDB:7abi7	0.218	0.166	2.313	236	0.091	0.068	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
20	PDB:6pgvA	0.151	0.169	2.447	152	0.063	0.072	6pgvA.pdb.gz	Structural insights into the activity and regulation of human Josephin-2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96T52	2.56e-128	358	175	1.000	1.000	IMP2L_HUMAN Mitochondrial inner membrane protease subunit 2 OS=Homo sapiens OX=9606 GN=IMMP2L PE=1 SV=1
2	Q8BPT6	1.70e-117	331	175	0.914	0.914	IMP2L_MOUSE Mitochondrial inner membrane protease subunit 2 OS=Mus musculus OX=10090 GN=Immp2l PE=1 SV=1
3	P46972	3.88e-32	115	177	0.371	0.367	IMP2_YEAST Mitochondrial inner membrane protease subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMP2 PE=1 SV=1
4	Q9UST2	3.00e-30	110	180	0.377	0.367	IMP2L_SCHPO Mitochondrial inner membrane protease subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC336.13c PE=3 SV=1
5	Q6NLT8	1.79e-21	87.8	168	0.314	0.327	IMP1A_ARATH Mitochondrial ATP-independent inner membrane protease subunit 1a OS=Arabidopsis thaliana OX=3702 GN=IMP1A PE=2 SV=1
6	Q96LU5	1.27e-20	85.5	166	0.269	0.283	IMP1L_HUMAN Mitochondrial inner membrane protease subunit 1 OS=Homo sapiens OX=9606 GN=IMMP1L PE=2 SV=1
7	Q9CQU8	4.63e-20	84.0	166	0.257	0.271	IMP1L_MOUSE Mitochondrial inner membrane protease subunit 1 OS=Mus musculus OX=10090 GN=Immp1l PE=1 SV=1
8	O74800	4.12e-18	78.6	157	0.246	0.274	IMP1_SCHPO Mitochondrial inner membrane protease subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imp1 PE=3 SV=1
9	P28627	1.51e-11	62.0	190	0.223	0.205	IMP1_YEAST Mitochondrial inner membrane protease subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMP1 PE=1 SV=3
10	E9PIG6	8.68e-09	52.8	107	0.166	0.271	E9PIG6_HUMAN Mitochondrial inner membrane protease subunit (Fragment) OS=Homo sapiens OX=9606 GN=IMMP1L PE=1 SV=1
11	O04348	9.79e-09	55.5	340	0.234	0.121	TPP1_ARATH Thylakoidal processing peptidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TPP1 PE=2 SV=2
12	E9PNR7	1.15e-08	52.4	96	0.166	0.302	E9PNR7_HUMAN Mitochondrial inner membrane protease subunit (Fragment) OS=Homo sapiens OX=9606 GN=IMMP1L PE=3 SV=1
13	Q8H0W1	2.21e-06	48.5	291	0.234	0.141	PLSP1_ARATH Chloroplast processing peptidase OS=Arabidopsis thaliana OX=3702 GN=PLSP1 PE=2 SV=2
14	Q84VZ6	7.41e-05	43.9	205	0.183	0.156	IMP2_ARATH Mitochondrial ATP-independent inner membrane protease subunit 2 OS=Arabidopsis thaliana OX=3702 GN=IMP1B PE=2 SV=1
15	P9WKA1	2.13e-04	42.7	294	0.149	0.088	LEP_MYCTU Signal peptidase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lepB PE=1 SV=1
16	Q9I5G7	0.002	39.7	284	0.171	0.106	LEP_PSEAE Signal peptidase I OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lepB PE=3 SV=1
17	Q9I441	0.019	36.6	179	0.251	0.246	Q9I441_PSEAE Signal peptidase I OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1303 PE=3 SV=1
18	Q38BE2	0.72	32.0	207	0.269	0.227	Q38BE2_TRYB2 Mitochondrial inner membrane signal peptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2630 PE=4 SV=1
19	Q9VQW1	0.73	32.7	1198	0.143	0.021	Q9VQW1_DROME Friend of echinoid, isoform G OS=Drosophila melanogaster OX=7227 GN=fred PE=1 SV=4
20	M9NCR3	0.81	32.3	1323	0.143	0.019	M9NCR3_DROME Friend of echinoid, isoform F OS=Drosophila melanogaster OX=7227 GN=fred PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11391 DUF2798	2.2e+02	13.3	Protein of unknown function (DUF2798)
2	PF00717 Peptidase_S24	23	16.2	Peptidase S24-like
3	PF10502 Peptidase_S26	3.6e-17	74.3	Signal peptidase, peptidase S26

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384966

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000436785	0.790	Solute carrier family 35 member F2
2	9606.ENSP00000382104	0.781	Protein dopey-2
3	9606.ENSP00000398495	0.739	Diablo homolog, mitochondrial
4	9606.ENSP00000397312	0.733	Leucine-rich repeat neuronal protein 3
5	9606.ENSP00000296805	0.726	Ribosome-releasing factor 2, mitochondrial
6	9606.ENSP00000238788	0.725	Transmembrane protein 214
7	9606.ENSP00000369395	0.710	Leucine-rich repeat-containing protein 19
8	9606.ENSP00000333934	0.704	tRNA (guanine(10)-N2)-methyltransferase homolog
9	9606.ENSP00000330148	0.702	Glutamate receptor ionotropic, delta-1
10	9606.ENSP00000300145	0.690	Mitochondrial inner membrane protease ATP23 homolog
11	9606.ENSP00000340672	0.686	Armadillo repeat-containing X-linked protein 3
12	9606.ENSP00000278200	0.684	Mitochondrial inner membrane protease subunit 1
13	9606.ENSP00000435954	0.671	Potassium voltage-gated channel subfamily V member 1
14	9606.ENSP00000404179	0.670	Dedicator of cytokinesis protein 4
15	9606.ENSP00000347719	0.656	Tubulin-specific chaperone D
16	9606.ENSP00000302564	0.655	Bcl-2-like protein 1
17	9606.ENSP00000325421	0.647	Presenilins-associated rhomboid-like protein, mitochondrial
18	9606.ENSP00000360270	0.646	Metalloendopeptidase OMA1, mitochondrial
19	9606.ENSP00000359521	0.641	SLIT and NTRK-like protein 2
20	9606.ENSP00000355471	0.630	Dimethyladenosine transferase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008233	1.000	peptidase activity
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007005	0.989	mitochondrion organization
GO:0051604	0.989	protein maturation
GO:0033365	0.986	protein localization to organelle
GO:0070585	0.981	protein localization to mitochondrion
GO:0046907	0.980	intracellular transport
GO:0006508	0.977	proteolysis
GO:0006605	0.966	protein targeting
GO:0006839	0.965	mitochondrial transport
GO:0016485	0.963	protein processing
GO:0072594	0.961	establishment of protein localization to organelle
GO:0006626	0.949	protein targeting to mitochondrion
GO:0044237	0.773	cellular metabolic process
GO:0032501	0.672	multicellular organismal process
GO:0050896	0.669	response to stimulus
GO:0032502	0.456	developmental process
GO:0048856	0.419	anatomical structure development
GO:0007275	0.384	multicellular organism development
GO:0044085	0.306	cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005739	1.000	mitochondrion
GO:0031090	0.988	organelle membrane
GO:0032991	0.986	protein-containing complex
GO:0005740	0.967	mitochondrial envelope
GO:0031966	0.951	mitochondrial membrane
GO:0019866	0.895	organelle inner membrane
GO:0098796	0.894	membrane protein complex
GO:0005743	0.870	mitochondrial inner membrane
GO:1902494	0.771	catalytic complex
GO:0098798	0.724	mitochondrial protein-containing complex
GO:0098800	0.522	inner mitochondrial membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]