StarFunc result for job id Q96T58

User Input

>input (1400 residues)
MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQ
KAHNSVNKMGDRDLRTDYNEPGTIPSAARGLDDTVSIASRSREVSGFRGGGGGPAYGPPP
SLHAREGRYERRLDGASDNRERAYEHSAYGHHERGTGGFDRTRHYDQDYYRDPRERTLQH
GLYYASRSRSPNRFDAHDPRYEPRAREQFTLPSVVHRDIYRDDITREVRGRRPERNYQHS
RSRSPHSSQSRNQSPQRLASQASRPTRSPSGSGSRSRSSSSDSISSSSSTSSDSSDSSSS
SSDDSPARSVQSAAVPAPTSQLLSSLEKDEPRKSFGIKVQNLPVRSTDTSLKDGLFHEFK
KFGKVTSVQIHGTSEERYGLVFFRQQEDQEKALTASKGKLFFGMQIEVTAWIGPETESEN
EFRPLDERIDEFHPKATRTLFIGNLEKTTTYHDLRNIFQRFGEIVDIDIKKVNGVPQYAF
LQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDGLSSNVSDQYLTRHFCRY
GPVVKVVFDRLKGMALVLYNEIEYAQAAVKETKGRKIGGNKIKVDFANRESQLAFYHCME
KSGQDIRDFYEMLAERREERRASYDYNQDRTYYESVRTPGTYPEDSRRDYPARGREFYSE
WETYQGDYYESRYYDDPREYRDYRNDPYEQDIREYSYRQRERERERERFESDRDRDHERR
PIERSQSPVHLRRPQSPGASPSQAERLPSDSERRLYSRSSDRSGSCSSLSPPRYEKLDKS
RLERYTKNEKTDKERTFDPERVERERRLIRKEKVEKDKTDKQKRKGKVHSPSSQSSETDQ
ENEREQSPEKPRSCNKLSREKADKEGIAKNRLELMPCVVLTRVKEKEGKVIDHTPVEKLK
AKLDNDTVKSSALDQKLQVSQTEPAKSDLSKLESVRMKVPKEKGLSSHVEVVEKEGRLKA
RKHLKPEQPADGVSAVDLEKLEARKRRFADSNLKAEKQKPEVKKSSPEMEDARVLSKKQP
DVSSREVILLREGEAERKPVRKEILKRESKKIKLDRLNTVASPKDCQELASISVGSGSRP
SSDLQARLGELAGESVENQEVQSKKPIPSKPQLKQLQVLDDQGPEREDVRKNYCSLRDET
PERKSGQEKSHSVNTEEKIGIDIDHTQSYRKQMEQSRRKQQMEMEIAKSEKFGSPKKDVD
EYERRSLVHEVGKPPQDVTDDSPPSKKKRMDHVDFDICTKRERNYRSSRQISEDSERTGG
SPSVRHGSFHEDEDPIGSPRLLSVKGSPKVDEKVLPYSNITVREESLKFNPYDSSRREQM
ADMAKIKLSVLNSEDELNRWDSQMKQDAGRFDVSFPNSIIKRDSLRKRSVRDLEPGEVPS
DSDEDGEHKSHSPRASALYE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5EGK6	0.104	0.061	3.045E-18	2407	0.155	0.090	G5EGK6.pdb.gz	DIN1_CAEEL Daf-12-interacting protein 1 OS=Caenorhabditis elegans OX=6239 GN=din-1 PE=1 SV=1
2	AFDB:P38741	0.086	0.143	1.177E-14	713	0.070	0.137	P38741.pdb.gz	RIM4_YEAST Meiotic activator RIM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIM4 PE=1 SV=1
3	AFDB:Q8IXT5	0.072	0.090	6.821E-14	1001	0.110	0.154	Q8IXT5.pdb.gz	RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2
4	PDB:5vsuA	0.061	0.185	3.655E-13	387	0.031	0.114	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
5	AFDB:Q9VHC7	0.054	0.114	2.531E-11	632	0.051	0.112	Q9VHC7.pdb.gz	Q9VHC7_DROME FI21236p1 OS=Drosophila melanogaster OX=7227 GN=rump PE=1 SV=1
6	PDB:7oqcF	0.057	0.280	7.551E-11	267	0.036	0.187	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
7	AFDB:Q08170	0.059	0.146	1.467E-10	494	0.077	0.219	Q08170.pdb.gz	SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2
8	AFDB:Q8VWF5	0.072	0.112	2.963E-10	800	0.079	0.138	Q8VWF5.pdb.gz	AML5_ARATH Protein MEI2-like 5 OS=Arabidopsis thaliana OX=3702 GN=ML5 PE=1 SV=1
9	PDB:6r5kH	0.060	0.181	5.867E-10	394	0.044	0.155	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
10	AFDB:Q1LY77	0.060	0.048	1.528E-9	1844	0.165	0.125	Q1LY77.pdb.gz	SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio OX=7955 GN=setd1ba PE=1 SV=2
11	AFDB:Q7SXT6	0.056	0.180	2.441E-9	408	0.046	0.157	Q7SXT6.pdb.gz	Q7SXT6_DANRE Musashi RNA-binding protein 2b OS=Danio rerio OX=7955 GN=msi2 PE=2 SV=1
12	AFDB:A0A0S2Z569	0.068	0.195	3.086E-9	407	0.049	0.170	A0A0S2Z569.pdb.gz	A0A0S2Z569_HUMAN DAZ associated protein 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=DAZAP1 PE=2 SV=1
13	AFDB:E9PNI7	0.070	0.089	3.901E-9	1037	0.059	0.080	E9PNI7.pdb.gz	E9PNI7_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
14	PDB:7evoD	0.054	0.361	4.558E-9	200	0.024	0.170	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
15	PDB:5lsbA	0.055	0.385	5.125E-9	176	0.025	0.199	5lsbA.pdb.gz
16	PDB:6y53o	0.051	0.423	1.097E-8	160	0.021	0.188	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
17	PDB:6y5qq	0.054	0.388	2.492E-8	178	0.023	0.180	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:6ff7X	0.059	0.441	4.222E-8	171	0.025	0.205	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:3lqvB	0.056	0.636	2.703E-6	115	0.014	0.174	3lqvB.pdb.gz	Branch Recognition by SF3b14
20	PDB:6qx91K	0.053	0.352	1.040E-5	201	0.021	0.144	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A669KB49	0.0	1456	704	0.503	1.000	A0A669KB49_HUMAN Spen family transcriptional repressor (Fragment) OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1
2	F6WRY4	0.0	562	373	0.199	0.748	F6WRY4_HUMAN Spen family transcriptional repressor OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=2
3	Q62504	0.0	2322	3644	0.864	0.332	MINT_MOUSE Msx2-interacting protein OS=Mus musculus OX=10090 GN=Spen PE=1 SV=2
4	Q96T58	0.0	2901	3664	1.000	0.382	MINT_HUMAN Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1
5	Q8SX83	8.95e-90	325	5560	0.109	0.027	SPEN_DROME Protein split ends OS=Drosophila melanogaster OX=7227 GN=spen PE=1 SV=2
6	Q0VBL3	3.87e-25	115	962	0.044	0.063	RBM15_MOUSE RNA-binding protein 15 OS=Mus musculus OX=10090 GN=Rbm15 PE=1 SV=1
7	A0A494C001	5.88e-25	115	896	0.044	0.068	A0A494C001_HUMAN RNA binding motif protein 15 OS=Homo sapiens OX=9606 GN=RBM15 PE=1 SV=2
8	A0A499FJY3	8.76e-25	114	925	0.044	0.066	A0A499FJY3_HUMAN RNA binding motif protein 15 OS=Homo sapiens OX=9606 GN=RBM15 PE=1 SV=1
9	Q96T37	9.81e-25	114	977	0.044	0.062	RBM15_HUMAN RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15 PE=1 SV=2
10	Q7KMJ6	1.22e-24	114	793	0.041	0.073	NITO_DROME RNA-binding protein spenito OS=Drosophila melanogaster OX=7227 GN=nito PE=1 SV=1
11	A0A087WWP4	1.25e-24	114	933	0.044	0.065	A0A087WWP4_HUMAN RNA binding motif protein 15 OS=Homo sapiens OX=9606 GN=RBM15 PE=1 SV=1
12	Q6PHZ5	6.86e-23	108	887	0.045	0.071	RB15B_MOUSE Putative RNA-binding protein 15B OS=Mus musculus OX=10090 GN=Rbm15b PE=1 SV=2
13	Q8NDT2	9.13e-23	108	890	0.042	0.066	RB15B_HUMAN Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3
14	H2KYB8	3.58e-13	76.3	520	0.035	0.094	H2KYB8_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=grld-1 PE=1 SV=1
15	Q8LPQ9	1.43e-12	75.1	901	0.031	0.048	FPA_ARATH Flowering time control protein FPA OS=Arabidopsis thaliana OX=3702 GN=FPA PE=1 SV=2
16	Q93194	8.04e-12	70.5	312	0.044	0.196	Q93194_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rnp-9 PE=4 SV=4
17	Q05196	1.82e-11	71.2	682	0.054	0.111	PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana OX=3702 GN=PAB5 PE=1 SV=3
18	F1QB54	3.65e-11	70.1	634	0.046	0.101	PABPA_DANRE Polyadenylate-binding protein 1A OS=Danio rerio OX=7955 GN=pabpc1a PE=1 SV=1
19	Q96DU9	6.62e-11	68.2	382	0.046	0.168	PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens OX=9606 GN=PABPC5 PE=1 SV=1
20	O60176	8.79e-10	65.1	473	0.031	0.091	YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC23E6.01c PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	1.4e-41	151.5	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF13893 RRM_5	2.3e-05	35.5	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16367 RRM_7	0.72	21.3	RNA recognition motif
4	PF16842 RRM_occluded	0.0035	28.5	Occluded RNA-recognition motif
5	PF17799 RRM_Rrp7	3e+02	12.6	Rrp7 RRM-like N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364912

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345206	0.998	Recombining binding protein suppressor of hairless
2	9606.ENSP00000384018	0.982	Nuclear receptor corepressor 2
3	9606.ENSP00000290921	0.966	C-terminal-binding protein 1
4	9606.ENSP00000263253	0.963	Histone acetyltransferase p300
5	9606.ENSP00000277541	0.962	Neurogenic locus notch homolog protein 1
6	9606.ENSP00000382628	0.932	DNA endonuclease RBBP8
7	9606.ENSP00000434552	0.921	Mastermind-like protein 2
8	9606.ENSP00000292599	0.918	Mastermind-like protein 1
9	9606.ENSP00000383042	0.916	Lysine-specific histone demethylase 1A
10	9606.ENSP00000262189	0.889	Histone-lysine N-methyltransferase 2C
11	9606.ENSP00000268712	0.833	Nuclear receptor corepressor 1
12	9606.ENSP00000301067	0.810	Histone-lysine N-methyltransferase 2D
13	9606.ENSP00000339883	0.769	Lamin-B receptor
14	9606.ENSP00000398837	0.753	Histone-lysine N-methyltransferase 2B
15	9606.ENSP00000256646	0.724	Neurogenic locus notch homolog protein 2
16	9606.ENSP00000436786	0.699	Histone-lysine N-methyltransferase 2A
17	9606.ENSP00000252542	0.691	Scaffold attachment factor B2
18	9606.ENSP00000442924	0.688	Histone-lysine N-methyltransferase SETD1B
19	9606.ENSP00000447173	0.680	Vitamin D3 receptor
20	9606.ENSP00000453293	0.653	Amyloid-beta A4 precursor protein-binding family A member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003714	0.998	transcription corepressor activity
GO:0003729	0.348	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045934	0.996	negative regulation of nucleobase-containing compound metabolic process
GO:0010468	0.986	regulation of gene expression
GO:0009889	0.933	regulation of biosynthetic process
GO:0051252	0.918	regulation of RNA metabolic process
GO:0010556	0.900	regulation of macromolecule biosynthetic process
GO:0048522	0.897	positive regulation of cellular process
GO:0031326	0.897	regulation of cellular biosynthetic process
GO:0051253	0.884	negative regulation of RNA metabolic process
GO:2001141	0.836	regulation of RNA biosynthetic process
GO:0006355	0.823	regulation of DNA-templated transcription
GO:0050793	0.793	regulation of developmental process
GO:0006357	0.780	regulation of transcription by RNA polymerase II
GO:0010558	0.675	negative regulation of macromolecule biosynthetic process
GO:0031327	0.675	negative regulation of cellular biosynthetic process
GO:0051239	0.636	regulation of multicellular organismal process
GO:0045595	0.621	regulation of cell differentiation
GO:2000026	0.570	regulation of multicellular organismal development
GO:0045892	0.543	negative regulation of DNA-templated transcription
GO:0051960	0.525	regulation of nervous system development
GO:0060284	0.423	regulation of cell development
GO:0000122	0.333	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0032991	0.646	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]