StarFunc result for job id Q96T60

User Input

>input (521 residues)
MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADPETR
TVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPP
GTPLVSQDEKRDAELPKKRMRKSNPGWENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTR
SGKVFPTGPSDWRILYPEIPRKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVV
EKLGVPFQVLVATHAGLYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPG
RKKKDFSCADRLFALNLGLPFATPEEFFLKWPAAGFELPAFDPRTVSRSGPLCLPESRAL
LSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTTCETALKQGKRVA
IDNTNPDAASRARYVQCARAAGVPCRCFLFTATLEQARHNNRFREMTDSSHIPVSDMVMY
GYRKQFEAPTLAEGFSAILEIPFRLWVEPRLGRLYCQFSEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96T60	1.000	1.000	0.000	521	1.000	1.000	Q96T60.pdb.gz	PNKP_HUMAN Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens OX=9606 GN=PNKP PE=1 SV=1
2	AFDB:Q9JLV6	0.924	0.922	4.551E-102	522	0.810	0.808	Q9JLV6.pdb.gz	PNKP_MOUSE Bifunctional polynucleotide phosphatase/kinase OS=Mus musculus OX=10090 GN=Pnkp PE=1 SV=2
3	AFDB:A0A0G2JUH4	0.969	0.922	3.633E-101	548	0.814	0.774	A0A0G2JUH4.pdb.gz	A0A0G2JUH4_RAT Polynucleotide kinase 3'-phosphatase OS=Rattus norvegicus OX=10116 GN=Pnkp PE=1 SV=2
4	AFDB:M0QYH2	0.675	0.716	2.733E-100	490	0.940	1.000	M0QYH2.pdb.gz	M0QYH2_HUMAN Polynucleotide kinase 3'-phosphatase OS=Homo sapiens OX=9606 GN=PNKP PE=1 SV=1
5	AFDB:A0A0D9SFL2	0.672	0.721	3.114E-99	485	0.931	1.000	A0A0D9SFL2.pdb.gz	A0A0D9SFL2_HUMAN Polynucleotide kinase 3'-phosphatase OS=Homo sapiens OX=9606 GN=PNKP PE=1 SV=1
6	AFDB:M0R3C8	0.495	0.564	2.912E-75	455	0.760	0.870	M0R3C8.pdb.gz	M0R3C8_HUMAN Polynucleotide kinase 3'-phosphatase OS=Homo sapiens OX=9606 GN=PNKP PE=1 SV=1
7	AFDB:Q19683	0.694	0.883	3.935E-50	407	0.338	0.432	Q19683.pdb.gz	YZR5_CAEEL Uncharacterized protein F21D5.5 OS=Caenorhabditis elegans OX=6239 GN=F21D5.5 PE=2 SV=2
8	AFDB:O13911	0.635	0.804	1.371E-39	408	0.255	0.326	O13911.pdb.gz	PNK1_SCHPO Bifunctional polynucleotide phosphatase/kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pnk1 PE=1 SV=2
9	AFDB:Q585Q2	0.637	0.694	2.967E-34	476	0.267	0.292	Q585Q2.pdb.gz	Q585Q2_TRYB2 Polynucleotide kinase 3'-phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.320 PE=4 SV=1
10	AFDB:Q8ID74	0.628	0.704	1.621E-30	462	0.207	0.234	Q8ID74.pdb.gz	Q8ID74_PLAF7 Bifunctional polynucleotide phosphatase/kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1363200 PE=4 SV=1
11	PDB:3l8eA	0.204	0.536	1.002E-5	185	0.060	0.168	3l8eA.pdb.gz	Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) .
12	PDB:3l8hA	0.230	0.593	1.924E-5	179	0.063	0.184	3l8hA.pdb.gz	Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) .
13	PDB:1bifA	0.221	0.262	3.093E-5	432	0.060	0.072	1bifA.pdb.gz	The crystal structure of the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase reveals distinct domain homologies.
14	PDB:1gvnB	0.231	0.418	9.553E-5	272	0.046	0.088	1gvnB.pdb.gz
15	PDB:1ko5A	0.208	0.542	1.285E-4	172	0.031	0.093	1ko5A.pdb.gz	Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
16	PDB:1k6mA	0.203	0.238	1.364E-4	432	0.063	0.076	1k6mA.pdb.gz	Tissue-specific structure/function differentiation of the liver isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.
17	PDB:1qf9A	0.214	0.503	1.536E-4	194	0.060	0.160	1qf9A.pdb.gz	pH influences fluoride coordination number of the AlFx phosphoryl transfer transition state analog.
18	PDB:5htkA	0.214	0.255	1.536E-4	425	0.052	0.064	5htkA.pdb.gz	Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
19	PDB:2axnA	0.197	0.222	3.131E-4	451	0.058	0.067	2axnA.pdb.gz	Crystal structure of the hypoxia-inducible form of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3): a possible new target for cancer therapy.
20	PDB:2ia5H	0.200	0.335	4.743E-4	301	0.054	0.093	2ia5H.pdb.gz	Structure-function analysis of the 3' phosphatase component of T4 polynucleotide kinase/phosphatase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D9SFL2	0.0	976	485	0.931	1.000	A0A0D9SFL2_HUMAN Polynucleotide kinase 3'-phosphatase OS=Homo sapiens OX=9606 GN=PNKP PE=1 SV=1
2	A0A0G2JUH4	0.0	817	525	0.777	0.771	A0A0G2JUH4_RAT Polynucleotide kinase 3'-phosphatase OS=Rattus norvegicus OX=10116 GN=Pnkp PE=1 SV=2
3	A0A8I6AJP5	0.0	794	486	0.752	0.807	A0A8I6AJP5_RAT Polynucleotide kinase 3'-phosphatase OS=Rattus norvegicus OX=10116 GN=Pnkp PE=1 SV=1
4	F7F4C1	0.0	769	476	0.735	0.805	F7F4C1_RAT Polynucleotide kinase 3'-phosphatase OS=Rattus norvegicus OX=10116 GN=Pnkp PE=1 SV=1
5	M0QYH2	0.0	985	490	0.940	1.000	M0QYH2_HUMAN Polynucleotide kinase 3'-phosphatase OS=Homo sapiens OX=9606 GN=PNKP PE=1 SV=1
6	M0R3C8	0.0	798	455	0.760	0.870	M0R3C8_HUMAN Polynucleotide kinase 3'-phosphatase OS=Homo sapiens OX=9606 GN=PNKP PE=1 SV=1
7	Q6AXV0	0.0	875	522	0.814	0.812	Q6AXV0_RAT Polynucleotide kinase 3'-phosphatase OS=Rattus norvegicus OX=10116 GN=Pnkp PE=1 SV=1
8	Q96T60	0.0	1065	521	1.000	1.000	PNKP_HUMAN Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens OX=9606 GN=PNKP PE=1 SV=1
9	Q9JLV6	0.0	862	522	0.810	0.808	PNKP_MOUSE Bifunctional polynucleotide phosphatase/kinase OS=Mus musculus OX=10090 GN=Pnkp PE=1 SV=2
10	M0QYI1	5.93e-175	494	247	0.474	1.000	M0QYI1_HUMAN Polynucleotide kinase 3'-phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=PNKP PE=1 SV=2
11	M0R000	1.76e-120	353	176	0.338	1.000	M0R000_HUMAN Polynucleotide kinase 3'-phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=PNKP PE=1 SV=2
12	Q19683	2.68e-108	330	407	0.328	0.420	YZR5_CAEEL Uncharacterized protein F21D5.5 OS=Caenorhabditis elegans OX=6239 GN=F21D5.5 PE=2 SV=2
13	O13911	1.81e-68	227	408	0.248	0.316	PNK1_SCHPO Bifunctional polynucleotide phosphatase/kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pnk1 PE=1 SV=2
14	Q585Q2	9.12e-56	196	476	0.271	0.296	Q585Q2_TRYB2 Polynucleotide kinase 3'-phosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.320 PE=4 SV=1
15	Q8ID74	9.84e-32	129	462	0.198	0.223	Q8ID74_PLAF7 Bifunctional polynucleotide phosphatase/kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1363200 PE=4 SV=1
16	Q84JE8	1.25e-29	125	694	0.148	0.111	ZDP_ARATH Polynucleotide 3'-phosphatase ZDP OS=Arabidopsis thaliana OX=3702 GN=ZDP PE=1 SV=1
17	Q7TQC5	4.59e-13	72.8	342	0.083	0.126	APTX_MOUSE Aprataxin OS=Mus musculus OX=10090 GN=Aptx PE=1 SV=2
18	Q7Z2E3	4.88e-13	72.8	356	0.077	0.112	APTX_HUMAN Aprataxin OS=Homo sapiens OX=9606 GN=APTX PE=1 SV=2
19	C9J8U3	5.77e-05	47.4	303	0.050	0.086	C9J8U3_HUMAN Aprataxin OS=Homo sapiens OX=9606 GN=APTX PE=1 SV=2
20	Q03796	1.11e-04	46.2	238	0.100	0.218	TPP1_YEAST Polynucleotide 3'-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13207 AAA_17	2.2e+02	13.7	AAA domain
2	PF13604 AAA_30	4.1e+02	12.1	AAA domain
3	PF13671 AAA_33	2.1e-15	68.6	AAA domain
4	PF02492 cobW	7.6e+02	11.1	CobW/HypB/UreG, nucleotide-binding domain
5	PF17913 FHA_2	2.8e-23	93.3	FHA domain
6	PF12710 HAD	14	17.6	haloacid dehalogenase-like hydrolase
7	PF13419 HAD_2	4.7e+02	12.3	Haloacid dehalogenase-like hydrolase
8	PF00702 Hydrolase	2.5e+02	13.3	haloacid dehalogenase-like hydrolase
9	PF13344 Hydrolase_6	14	17.2	Haloacid dehalogenase-like hydrolase
10	PF08645 PNK3P	3.6e-51	184.5	Polynucleotide kinase 3 phosphatase
11	PF06414 Zeta_toxin	10	17.0	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323511

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262887	0.999	DNA repair protein XRCC1
2	9606.ENSP00000421491	0.999	DNA repair protein XRCC4
3	9606.ENSP00000265421	0.988	DNA polymerase beta
4	9606.ENSP00000484288	0.986	DNA ligase 4
5	9606.ENSP00000367787	0.985	DNA ligase 3
6	9606.ENSP00000352257	0.984	X-ray repair cross-complementing protein 6
7	9606.ENSP00000375978	0.979	X-ray repair cross-complementing protein 5
8	9606.ENSP00000313420	0.971	DNA-dependent protein kinase catalytic subunit
9	9606.ENSP00000337353	0.960	Tyrosyl-DNA phosphodiesterase 1
10	9606.ENSP00000379174	0.955	DNA-directed DNA/RNA polymerase mu
11	9606.ENSP00000367527	0.931	Protein artemis
12	9606.ENSP00000284503	0.915	Endonuclease 8-like 2
13	9606.ENSP00000347170	0.903	Endonuclease 8-like 1
14	9606.ENSP00000216714	0.881	DNA-(apurinic or apyrimidinic site) lyase
15	9606.ENSP00000364126	0.846	DNA-(apurinic or apyrimidinic site) lyase 2
16	9606.ENSP00000300087	0.797	Dynactin subunit 5
17	9606.ENSP00000219066	0.793	Endonuclease III-like protein 1
18	9606.ENSP00000306561	0.793	N-glycosylase/DNA lyase
19	9606.ENSP00000357459	0.793	Double-stranded RNA-specific adenosine deaminase
20	9606.ENSP00000305480	0.776	Flap endonuclease 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016791	0.999	phosphatase activity
GO:0003677	0.998	DNA binding
GO:0019205	0.997	nucleobase-containing compound kinase activity
GO:0003690	0.991	double-stranded DNA binding
GO:0016773	0.975	phosphotransferase activity, alcohol group as acceptor
GO:0046403	0.826	polynucleotide 3'-phosphatase activity
GO:0051734	0.778	polynucleotide kinase activity
GO:0046404	0.518	polydeoxyribonucleotide 5'-hydroxyl-kinase activity
GO:1990756	0.471	ubiquitin ligase-substrate adaptor activity
GO:0140640	0.347	catalytic activity, acting on a nucleic acid
GO:0140097	0.306	catalytic activity, acting on DNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006139	0.992	nucleobase-containing compound metabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:0050896	0.984	response to stimulus
GO:0006259	0.983	DNA metabolic process
GO:0050789	0.979	regulation of biological process
GO:0019222	0.960	regulation of metabolic process
GO:0006281	0.945	DNA repair
GO:0080090	0.944	regulation of primary metabolic process
GO:0060255	0.944	regulation of macromolecule metabolic process
GO:0050794	0.938	regulation of cellular process
GO:0051171	0.934	regulation of nitrogen compound metabolic process
GO:0019219	0.852	regulation of nucleobase-containing compound metabolic process
GO:0051052	0.839	regulation of DNA metabolic process
GO:0006302	0.764	double-strand break repair
GO:0048518	0.649	positive regulation of biological process
GO:0048522	0.632	positive regulation of cellular process
GO:0045935	0.568	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.536	positive regulation of macromolecule metabolic process
GO:0006284	0.522	base-excision repair
GO:0048583	0.493	regulation of response to stimulus
GO:0010556	0.488	regulation of macromolecule biosynthetic process
GO:0031326	0.488	regulation of cellular biosynthetic process
GO:0006303	0.429	double-strand break repair via nonhomologous end joining
GO:2001020	0.393	regulation of response to DNA damage stimulus
GO:0065009	0.388	regulation of molecular function
GO:0006282	0.364	regulation of DNA repair
GO:0051054	0.357	positive regulation of DNA metabolic process
GO:0050790	0.353	regulation of catalytic activity
GO:0033044	0.349	regulation of chromosome organization
GO:0006793	0.333	phosphorus metabolic process
GO:0048584	0.311	positive regulation of response to stimulus
GO:0006796	0.308	phosphate-containing compound metabolic process
GO:1901564	0.305	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005730	0.995	nucleolus
GO:0016020	0.893	membrane
GO:0005694	0.842	chromosome
GO:0005737	0.717	cytoplasm
GO:0032991	0.576	protein-containing complex
GO:0035861	0.366	site of double-strand break
GO:1902494	0.303	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	0.999	Transferring phosphorus-containing groups.
EC:3.1.3.-	0.999	Phosphoric monoester hydrolases.
EC:2.7.1.-	0.975	Phosphotransferases with an alcohol group as acceptor.
RHEA:14113	0.826	a 3'end (2'-deoxyribonucleotide 3'-phosphate)-DNA + H2O = a 3'-end 2'-deoxyribonucleotide-DNA + phosphate
EC:3.1.3.32	0.826	polynucleotide 3'-phosphatase.
RHEA:54580	0.778	a 5'-end dephospho-ribonucleoside-RNA + ATP = a 5'-end 5'-monophospho-ribonucleoside-RNA + ADP + H(+)
EC:2.7.1.78	0.778	polynucleotide 5'-hydroxyl-kinase.
RHEA:15669	0.518	a 5'-end dephospho-2'-deoxyribonucleoside-DNA + ATP = a 5'-end 5'-monophospho-2'-deoxyribonucleoside-DNA + ADP + H(+)

[back to server]