StarFunc result for job id Q96T76

User Input

>input (1030 residues)
MAAAAAVEAAAPMGALWGLVHDFVVGQQEGPADQVAADVKSGNYTVLQVVEALGSSLENP
EPRTRARAIQLLSQVLLHCHTLLLEKEVVHLILFYENRLKDHHLVIPSVLQGLKALSLCV
ALPPGLAVSVLKAIFQEVHVQSLPQVDRHTVYNIITNFMRTREEELKSLGADFTFGFIQV
MDGEKDPRNLLVAFRIVHDLISRDYSLGPFVEELFEVTSCYFPIDFTPPPNDPHGIQRED
LILSLRAVLASTPRFAEFLLPLLIEKVDSEVLSAKLDSLQTLNACCAVYGQKELKDFLPS
LWASIRREVFQTASERVEAEGLAALHSLTACLSRSVLRADAEDLLDSFLSNILQDCRHHL
CEPDMKLVWPSAKLLQAAAGASARACDSVTSNVLPLLLEQFHKHSQSSQRRTILEMLLGF
LKLQQKWSYEDKDQRPLNGFKDQLCSLVFMALTDPSTQLQLVGIRTLTVLGAQPDLLSYE
DLELAVGHLYRLSFLKEDSQSCRVAALEASGTLAALYPVAFSSHLVPKLAEELRVGESNL
TNGDEPTQCSRHLCCLQALSAVSTHPSIVKETLPLLLQHLWQVNRGNMVAQSSDVIAVCQ
SLRQMAEKCQQDPESCWYFHQTAIPCLLALAVQASMPEKEPSVLRKVLLEDEVLAAMVSV
IGTATTHLSPELAAQSVTHIVPLFLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMA
FVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQL
AVDKVEAGLGSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADG
FSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPQDVKPNYLKGLSHVLN
RLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFL
NLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKPLDDKKRLVRKEAVSARG
EWFLLGSPGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96T76	1.000	1.000	0.000	1030	1.000	1.000	Q96T76.pdb.gz	MMS19_HUMAN MMS19 nucleotide excision repair protein homolog OS=Homo sapiens OX=9606 GN=MMS19 PE=1 SV=2
2	AFDB:Q9D071	0.992	0.991	0.000	1031	0.900	0.899	Q9D071.pdb.gz	MMS19_MOUSE MMS19 nucleotide excision repair protein homolog OS=Mus musculus OX=10090 GN=Mms19 PE=1 SV=1
3	PDB:6tc0C	0.697	0.718	2.544E-85	994	0.877	0.908	6tc0C.pdb.gz
4	AFDB:Q9UTR1	0.741	0.748	4.112E-35	1018	0.226	0.229	Q9UTR1.pdb.gz	MMS19_SCHPO DNA repair/transcription protein mms19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mms19 PE=1 SV=1
5	AFDB:Q95U54	0.655	0.694	3.728E-34	959	0.235	0.252	Q95U54.pdb.gz	MMS19_DROME MMS19 nucleotide excision repair protein OS=Drosophila melanogaster OX=7227 GN=Mms19 PE=1 SV=1
6	AFDB:P40469	0.607	0.606	1.616E-32	1032	0.219	0.219	P40469.pdb.gz	MET18_YEAST DNA repair/transcription protein MET18/MMS19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET18 PE=1 SV=1
7	AFDB:Q57YW3	0.420	0.451	5.346E-17	947	0.162	0.176	Q57YW3.pdb.gz	Q57YW3_TRYB2 MMS19 nucleotide excision repair protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.670 PE=3 SV=1
8	AFDB:O75155	0.356	0.309	9.435E-13	1236	0.165	0.138	O75155.pdb.gz	CAND2_HUMAN Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens OX=9606 GN=CAND2 PE=1 SV=3
9	AFDB:Q9R0L4	0.248	0.213	2.215E-12	1273	0.161	0.130	Q9R0L4.pdb.gz	CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus OX=10116 GN=Cand2 PE=1 SV=1
10	AFDB:Q8L5Y6	0.271	0.240	2.646E-12	1219	0.139	0.117	Q8L5Y6.pdb.gz	CAND1_ARATH Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana OX=3702 GN=CAND1 PE=1 SV=1
11	AFDB:P97536	0.244	0.215	4.510E-12	1230	0.160	0.134	P97536.pdb.gz	CAND1_RAT Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus OX=10116 GN=Cand1 PE=1 SV=1
12	PDB:4a0cA	0.228	0.209	1.342E-11	1155	0.164	0.146	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
13	PDB:3w3uA	0.325	0.325	3.536E-10	1030	0.126	0.126	3w3uA.pdb.gz
14	PDB:6xu2A	0.326	0.310	6.949E-10	1091	0.140	0.132	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
15	PDB:4jlqA	0.251	0.291	9.316E-9	840	0.119	0.146	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
16	PDB:1qgkA	0.288	0.325	1.283E-8	876	0.127	0.150	1qgkA.pdb.gz
17	PDB:6ahd1	0.279	0.276	1.588E-8	1048	0.114	0.112	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
18	PDB:6zwmB	0.228	0.129	1.831E-8	2185	0.137	0.065	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
19	PDB:7unkA	0.245	0.242	1.831E-8	1047	0.146	0.143	7unkA.pdb.gz
20	PDB:2xwuB	0.271	0.298	2.348E-8	910	0.116	0.131	2xwuB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y746	0.0	1206	598	0.580	0.998	H0Y746_HUMAN MMS19 nucleotide excision repair protein (Fragment) OS=Homo sapiens OX=9606 GN=MMS19 PE=1 SV=1
2	Q96T76	0.0	2084	1030	1.000	1.000	MMS19_HUMAN MMS19 nucleotide excision repair protein homolog OS=Homo sapiens OX=9606 GN=MMS19 PE=1 SV=2
3	Q9D071	0.0	1812	1031	0.900	0.899	MMS19_MOUSE MMS19 nucleotide excision repair protein homolog OS=Mus musculus OX=10090 GN=Mms19 PE=1 SV=1
4	Q9UTR1	3.93e-58	219	1018	0.242	0.245	MMS19_SCHPO DNA repair/transcription protein mms19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mms19 PE=1 SV=1
5	Q95U54	6.46e-51	197	959	0.118	0.127	MMS19_DROME MMS19 nucleotide excision repair protein OS=Drosophila melanogaster OX=7227 GN=Mms19 PE=1 SV=1
6	P40469	3.78e-27	121	1032	0.126	0.126	MET18_YEAST DNA repair/transcription protein MET18/MMS19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET18 PE=1 SV=1
7	Q57YW3	3.04e-07	57.0	947	0.051	0.056	Q57YW3_TRYB2 MMS19 nucleotide excision repair protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.670 PE=3 SV=1
8	Q581B2	3.31e-07	57.0	947	0.051	0.056	Q581B2_TRYB2 MMS19 nucleotide excision repair protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10J17.300 PE=3 SV=1
9	P33892	0.072	39.7	2672	0.029	0.011	GCN1_YEAST eIF-2-alpha kinase activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN1 PE=1 SV=1
10	A0A140LI05	1.5	35.4	2566	0.021	0.009	A0A140LI05_MOUSE Mucin 16 (Fragment) OS=Mus musculus OX=10090 GN=Muc16 PE=1 SV=1
11	Q86XA9	2.5	34.7	2040	0.021	0.011	HTR5A_HUMAN HEAT repeat-containing protein 5A OS=Homo sapiens OX=9606 GN=HEATR5A PE=1 SV=2
12	A0A140LJ72	3.9	33.9	8478	0.021	0.003	A0A140LJ72_MOUSE Mucin 16 OS=Mus musculus OX=10090 GN=Muc16 PE=1 SV=1
13	O76331	6.2	33.1	893	0.025	0.029	O76331_DROME Transportin OS=Drosophila melanogaster OX=7227 GN=Tnpo PE=2 SV=1
14	Q5TB30	6.9	33.1	811	0.022	0.028	DEP1A_HUMAN DEP domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DEPDC1 PE=1 SV=2
15	Q6ES51	7.0	32.7	416	0.019	0.048	TIF6B_ORYSJ Protein TIFY 6b OS=Oryza sativa subsp. japonica OX=39947 GN=TIFY6B PE=1 SV=1
16	Q5B5C5	9.6	32.3	549	0.018	0.035	Q5B5C5_EMENI Phosphotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04255 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11919 DUF3437	0.069	24.3	Domain of unknown function (DUF3437)
2	PF02985 HEAT	4.8	18.7	HEAT repeat
3	PF13646 HEAT_2	0.00068	31.3	HEAT repeats
4	PF13513 HEAT_EZ	68	15.5	HEAT-like repeat
5	PF20210 Laa1_Sip1_HTR5	6.6e+02	11.6	Laa1/Sip1/HEATR5 HEAT repeat region
6	PF12460 MMS19_C	1e-105	365.9	RNAPII transcription regulator C-terminal
7	PF14500 MMS19_N	7.4e-85	296.2	Dos2-interacting transcription regulator of RNA-Pol-II
8	PF20168 PDS5	37	13.6	Sister chromatid cohesion protein PDS5 protein
9	PF10363 RTP1_C1	12	17.4	Required for nuclear transport of RNA pol II C-terminus 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000412698

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387471	0.999	Mitotic spindle-associated MMXD complex subunit MIP18
2	9606.ENSP00000418287	0.999	Probable cytosolic iron-sulfur protein assembly protein CIAO1
3	9606.ENSP00000251588	0.998	Cytosolic Fe-S cluster assembly factor NARFL
4	9606.ENSP00000375809	0.998	TFIIH basal transcription factor complex helicase XPD subunit
5	9606.ENSP00000300030	0.997	MIP18 family protein FAM96A
6	9606.ENSP00000353332	0.996	Regulator of telomere elongation helicase 1
7	9606.ENSP00000283027	0.991	Cytosolic Fe-S cluster assembly factor NUBP1
8	9606.ENSP00000406046	0.991	DNA polymerase delta catalytic subunit
9	9606.ENSP00000259008	0.985	Fanconi anemia group J protein
10	9606.ENSP00000360671	0.983	ADP/ATP translocase 2
11	9606.ENSP00000285398	0.980	TFIIH basal transcription factor complex helicase XPB subunit
12	9606.ENSP00000262302	0.975	Cytosolic Fe-S cluster assembly factor NUBP2
13	9606.ENSP00000265963	0.971	General transcription factor IIH subunit 1
14	9606.ENSP00000261245	0.968	CDK-activating kinase assembly factor MAT1
15	9606.ENSP00000259895	0.966	General transcription factor IIH subunit 4
16	9606.ENSP00000328901	0.962	General transcription factor IIH subunit 2
17	9606.ENSP00000256897	0.950	Cyclin-H
18	9606.ENSP00000445162	0.943	General transcription factor IIH subunit 3
19	9606.ENSP00000351185	0.939	DNA replication ATP-dependent helicase/nuclease DNA2
20	9606.ENSP00000256443	0.936	Cyclin-dependent kinase 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016922	0.940	nuclear receptor binding
GO:0030331	0.934	nuclear estrogen receptor binding
GO:0003713	0.836	transcription coactivator activity
GO:0019899	0.704	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.992	cellular metabolic process
GO:0065007	0.987	biological regulation
GO:0071704	0.981	organic substance metabolic process
GO:0044238	0.981	primary metabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0043170	0.973	macromolecule metabolic process
GO:0050789	0.972	regulation of biological process
GO:0006139	0.969	nucleobase-containing compound metabolic process
GO:0050794	0.963	regulation of cellular process
GO:0090304	0.963	nucleic acid metabolic process
GO:0031163	0.956	metallo-sulfur cluster assembly
GO:0010467	0.950	gene expression
GO:0044260	0.949	cellular macromolecule metabolic process
GO:0051171	0.947	regulation of nitrogen compound metabolic process
GO:0080090	0.942	regulation of primary metabolic process
GO:0031323	0.941	regulation of cellular metabolic process
GO:0060255	0.939	regulation of macromolecule metabolic process
GO:0006950	0.938	response to stress
GO:0051716	0.930	cellular response to stimulus
GO:0048522	0.928	positive regulation of cellular process
GO:0006259	0.895	DNA metabolic process
GO:0006974	0.893	cellular response to DNA damage stimulus
GO:0019219	0.857	regulation of nucleobase-containing compound metabolic process
GO:0006281	0.856	DNA repair
GO:0016226	0.842	iron-sulfur cluster assembly
GO:1901564	0.807	organonitrogen compound metabolic process
GO:0009893	0.778	positive regulation of metabolic process
GO:0051173	0.729	positive regulation of nitrogen compound metabolic process
GO:0031325	0.725	positive regulation of cellular metabolic process
GO:0010604	0.706	positive regulation of macromolecule metabolic process
GO:0031326	0.692	regulation of cellular biosynthetic process
GO:0010468	0.668	regulation of gene expression
GO:0019538	0.665	protein metabolic process
GO:0051252	0.628	regulation of RNA metabolic process
GO:0045935	0.550	positive regulation of nucleobase-containing compound metabolic process
GO:0010556	0.511	regulation of macromolecule biosynthetic process
GO:0006289	0.503	nucleotide-excision repair
GO:0051052	0.501	regulation of DNA metabolic process
GO:0048583	0.478	regulation of response to stimulus
GO:2001020	0.471	regulation of response to DNA damage stimulus
GO:0006355	0.468	regulation of DNA-templated transcription
GO:0031328	0.460	positive regulation of cellular biosynthetic process
GO:0010557	0.438	positive regulation of macromolecule biosynthetic process
GO:0006282	0.438	regulation of DNA repair
GO:0051254	0.437	positive regulation of RNA metabolic process
GO:0051054	0.429	positive regulation of DNA metabolic process
GO:1902680	0.425	positive regulation of RNA biosynthetic process
GO:0045893	0.416	positive regulation of DNA-templated transcription
GO:0048584	0.413	positive regulation of response to stimulus
GO:0007049	0.359	cell cycle
GO:1905168	0.342	positive regulation of double-strand break repair via homologous recombination
GO:0051604	0.340	protein maturation
GO:0022402	0.311	cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.999	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0016020	0.998	membrane
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0140535	0.963	intracellular protein-containing complex
GO:0005856	0.809	cytoskeleton
GO:0015630	0.800	microtubule cytoskeleton
GO:0005819	0.567	spindle
GO:0097361	0.452	CIA complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]