StarFunc result for job id Q96T88

User Input

>input (793 residues)
MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD
YEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSR
PADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEE
DVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYD
AEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGP
SCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYC
PECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGP
IPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTG
SGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVK
GGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKK
LGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAG
SPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLASLKDRPASGSPFQLFLSKVEE
TFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQT
VLNQLFPGYGNGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A087WTW0	0.522	0.486	0.000	857	1.000	0.925	A0A087WTW0.pdb.gz	A0A087WTW0_HUMAN E3 ubiquitin-protein ligase UHRF OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1
2	AFDB:E7EZF3	0.641	0.654	0.000	776	0.672	0.687	E7EZF3.pdb.gz	UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio OX=7955 GN=uhrf1 PE=1 SV=1
3	AFDB:Q7TMI3	0.649	0.641	0.000	803	0.565	0.558	Q7TMI3.pdb.gz	UHRF2_MOUSE E3 ubiquitin-protein ligase UHRF2 OS=Mus musculus OX=10090 GN=Uhrf2 PE=1 SV=1
4	AFDB:Q8VDF2	0.734	0.743	0.000	782	0.731	0.742	Q8VDF2.pdb.gz	UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus OX=10090 GN=Uhrf1 PE=1 SV=2
5	AFDB:Q8VYZ0	0.205	0.250	1.168E-25	645	0.211	0.259	Q8VYZ0.pdb.gz	ORTH2_ARATH E3 ubiquitin-protein ligase ORTHRUS 2 OS=Arabidopsis thaliana OX=3702 GN=ORTH2 PE=1 SV=1
6	AFDB:Q680I0	0.210	0.265	1.006E-24	623	0.195	0.249	Q680I0.pdb.gz	ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana OX=3702 GN=ORTH5 PE=2 SV=1
7	AFDB:Q681I0	0.194	0.324	6.609E-17	465	0.125	0.213	Q681I0.pdb.gz	ORTHL_ARATH E3 ubiquitin-protein ligase ORTHRUS-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=ORTHL PE=2 SV=1
8	AFDB:J9VHE9	0.213	0.470	1.028E-16	342	0.122	0.284	J9VHE9.pdb.gz	UHRF1_CRYNH UHRF1-like protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=UHF1 PE=3 SV=2
9	AFDB:P59232	0.101	0.468	3.220E-7	157	0.035	0.178	P59232.pdb.gz	R27AB_ARATH Ubiquitin-ribosomal protein eS31y fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPS27AB PE=2 SV=2
10	AFDB:P15357	0.096	0.462	6.601E-7	156	0.040	0.205	P15357.pdb.gz	RS27A_DROME Ubiquitin-ribosomal protein eS31 fusion protein OS=Drosophila melanogaster OX=7227 GN=RpS27A PE=1 SV=2
11	PDB:3dbhI	0.089	0.763	3.697E-5	86	0.033	0.302	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
12	PDB:6ef3u	0.089	0.848	4.611E-5	75	0.034	0.360	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
13	PDB:7rbsB	0.088	0.421	1.179E-4	157	0.026	0.134	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
14	PDB:3ai5A	0.089	0.233	1.470E-4	299	0.034	0.090	3ai5A.pdb.gz
15	PDB:6yvaC	0.092	0.453	1.642E-4	155	0.021	0.110	6yvaC.pdb.gz
16	PDB:6mdhA	0.087	0.437	2.852E-4	149	0.021	0.114	6mdhA.pdb.gz
17	PDB:4pyuA	0.089	0.854	1.134E-3	76	0.014	0.145	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
18	PDB:5xqmA	0.089	0.699	1.495E-3	90	0.018	0.156	5xqmA.pdb.gz
19	PDB:3plvA	0.086	0.809	1.580E-3	80	0.019	0.188	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
20	PDB:2lrwA	0.088	0.675	1.864E-3	78	0.029	0.295	2lrwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WTW0	0.0	1655	857	1.000	0.925	A0A087WTW0_HUMAN E3 ubiquitin-protein ligase UHRF OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1
2	A0A087WVR3	0.0	1654	806	1.000	0.984	A0A087WVR3_HUMAN E3 ubiquitin-protein ligase UHRF OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1
3	E7EZF3	0.0	1076	776	0.672	0.687	UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio OX=7955 GN=uhrf1 PE=1 SV=1
4	Q7TMI3	0.0	907	803	0.576	0.569	UHRF2_MOUSE E3 ubiquitin-protein ligase UHRF2 OS=Mus musculus OX=10090 GN=Uhrf2 PE=1 SV=1
5	Q7TPK1	0.0	1217	774	0.754	0.773	UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus OX=10116 GN=Uhrf1 PE=1 SV=2
6	Q8VDF2	0.0	1208	782	0.745	0.756	UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus OX=10090 GN=Uhrf1 PE=1 SV=2
7	Q96PU4	0.0	873	802	0.562	0.556	UHRF2_HUMAN E3 ubiquitin-protein ligase UHRF2 OS=Homo sapiens OX=9606 GN=UHRF2 PE=1 SV=1
8	Q96T88	0.0	1654	793	1.000	1.000	UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1
9	Q8VYZ0	2.59e-52	195	645	0.199	0.245	ORTH2_ARATH E3 ubiquitin-protein ligase ORTHRUS 2 OS=Arabidopsis thaliana OX=3702 GN=ORTH2 PE=1 SV=1
10	Q9FKA7	6.27e-51	191	617	0.183	0.235	ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana OX=3702 GN=ORTH1 PE=1 SV=1
11	Q680I0	5.35e-49	185	623	0.178	0.226	ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana OX=3702 GN=ORTH5 PE=2 SV=1
12	J9VHE9	1.48e-33	134	342	0.103	0.240	UHRF1_CRYNH UHRF1-like protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=UHF1 PE=3 SV=2
13	Q681I0	3.56e-33	135	465	0.136	0.232	ORTHL_ARATH E3 ubiquitin-protein ligase ORTHRUS-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=ORTHL PE=2 SV=1
14	O82175	1.94e-21	102	794	0.081	0.081	SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana OX=3702 GN=SUVH5 PE=1 SV=1
15	Q8GZB6	3.26e-19	94.7	624	0.084	0.107	SUVH4_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 OS=Arabidopsis thaliana OX=3702 GN=SUVH4 PE=1 SV=2
16	Q8VZ17	1.07e-18	93.6	790	0.078	0.078	SUVH6_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 OS=Arabidopsis thaliana OX=3702 GN=SUVH6 PE=1 SV=2
17	O22781	1.06e-15	83.6	651	0.076	0.092	SUVH2_ARATH Histone-lysine N-methyltransferase family member SUVH2 OS=Arabidopsis thaliana OX=3702 GN=SUVH2 PE=1 SV=1
18	Q9T0G7	3.05e-15	82.0	650	0.069	0.085	SUVH9_ARATH Histone-lysine N-methyltransferase family member SUVH9 OS=Arabidopsis thaliana OX=3702 GN=SUVH9 PE=1 SV=1
19	Q9FF80	5.71e-15	81.3	670	0.084	0.100	SUVH1_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Arabidopsis thaliana OX=3702 GN=SUVH1 PE=2 SV=1
20	Q9C5P4	1.51e-10	67.0	669	0.071	0.084	SUVH3_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Arabidopsis thaliana OX=3702 GN=SUVH3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12158 DUF3592	1.4e+02	14.0	Protein of unknown function (DUF3592)
2	PF00628 PHD	2.5e-08	45.0	PHD-finger
3	PF13831 PHD_2	1.6	19.6	PHD-finger
4	PF17758 Prot_ATP_OB_N	6.2e+02	11.6	Proteasomal ATPase OB N-terminal domain
5	PF11976 Rad60-SLD	7.7	17.7	Ubiquitin-2 like Rad60 SUMO-like
6	PF02182 SAD_SRA	8.1e-55	196.2	SAD/SRA domain
7	PF12148 TTD	1.7e-65	231.1	Tandem tudor domain within UHRF1
8	PF00240 ubiquitin	1.6e-13	61.5	Ubiquitin family
9	PF00097 zf-C3HC4	21	16.4	Zinc finger, C3HC4 type (RING finger)
10	PF13923 zf-C3HC4_2	1.5	20.0	Zinc finger, C3HC4 type (RING finger)
11	PF16685 zf-RING_10	10	17.7	zinc RING finger of MSL2
12	PF13639 zf-RING_2	42	15.9	Ring finger domain
13	PF14570 zf-RING_4	29	15.8	RING/Ubox like zinc-binding domain
14	PF14634 zf-RING_5	41	15.6	zinc-RING finger domain
15	PF13445 zf-RING_UBOX	30	16.1	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479617

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343535	0.999	Ubiquitin carboxyl-terminal hydrolase 7
2	9606.ENSP00000352516	0.999	DNA (cytosine-5)-methyltransferase 1
3	9606.ENSP00000476960	0.997	Histone cluster 2 H3 pseudogene 2
4	9606.ENSP00000362649	0.996	Histone deacetylase 1
5	9606.ENSP00000364678	0.992	Histone-lysine N-methyltransferase EHMT2
6	9606.ENSP00000263274	0.989	DNA ligase 1
7	9606.ENSP00000340330	0.986	Histone acetyltransferase KAT5
8	9606.ENSP00000264709	0.984	DNA (cytosine-5)-methyltransferase 3A
9	9606.ENSP00000333277	0.977	Histone cluster 2 H3 family member d
10	9606.ENSP00000355657	0.975	Histone H3.1t
11	9606.ENSP00000328547	0.945	DNA (cytosine-5)-methyltransferase 3B
12	9606.ENSP00000216122	0.929	DNA replication licensing factor MCM5
13	9606.ENSP00000265056	0.923	DNA replication licensing factor MCM2
14	9606.ENSP00000361540	0.916	Cell division cycle protein 20 homolog
15	9606.ENSP00000480826	0.916	Histone cluster 1 H3 family member a
16	9606.ENSP00000306968	0.911	Cell division cycle-associated protein 7
17	9606.ENSP00000274026	0.907	Cyclin-A2
18	9606.ENSP00000411532	0.906	DNA topoisomerase 2-alpha
19	9606.ENSP00000313950	0.903	Aurora kinase B
20	9606.ENSP00000376952	0.893	Crossover junction endonuclease EME1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004842	0.997	ubiquitin-protein transferase activity
GO:0003690	0.997	double-stranded DNA binding
GO:0035064	0.996	methylated histone binding
GO:0043167	0.988	ion binding
GO:0043565	0.988	sequence-specific DNA binding
GO:0042802	0.814	identical protein binding
GO:0046872	0.761	metal ion binding
GO:0046914	0.753	transition metal ion binding
GO:0061659	0.729	ubiquitin-like protein ligase activity
GO:0000166	0.719	nucleotide binding
GO:0061630	0.715	ubiquitin protein ligase activity
GO:0008327	0.683	methyl-CpG binding
GO:0044729	0.557	hemi-methylated DNA-binding
GO:0008270	0.442	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0071704	0.983	organic substance metabolic process
GO:0044237	0.983	cellular metabolic process
GO:0044238	0.980	primary metabolic process
GO:0071840	0.976	cellular component organization or biogenesis
GO:0010556	0.976	regulation of macromolecule biosynthetic process
GO:0031326	0.976	regulation of cellular biosynthetic process
GO:0019219	0.976	regulation of nucleobase-containing compound metabolic process
GO:0016043	0.972	cellular component organization
GO:0010468	0.971	regulation of gene expression
GO:0009892	0.970	negative regulation of metabolic process
GO:0044260	0.959	cellular macromolecule metabolic process
GO:2001141	0.950	regulation of RNA biosynthetic process
GO:0006807	0.947	nitrogen compound metabolic process
GO:0010605	0.947	negative regulation of macromolecule metabolic process
GO:0006355	0.941	regulation of DNA-templated transcription
GO:0048518	0.929	positive regulation of biological process
GO:1901360	0.925	organic cyclic compound metabolic process
GO:0046483	0.925	heterocycle metabolic process
GO:0090304	0.888	nucleic acid metabolic process
GO:0043412	0.857	macromolecule modification
GO:0006325	0.854	chromatin organization
GO:1901564	0.842	organonitrogen compound metabolic process
GO:0048523	0.835	negative regulation of cellular process
GO:0045934	0.826	negative regulation of nucleobase-containing compound metabolic process
GO:0019538	0.822	protein metabolic process
GO:0006259	0.785	DNA metabolic process
GO:0006357	0.779	regulation of transcription by RNA polymerase II
GO:0036211	0.746	protein modification process
GO:0009890	0.721	negative regulation of biosynthetic process
GO:0016567	0.690	protein ubiquitination
GO:0040029	0.676	epigenetic regulation of gene expression
GO:0051865	0.658	protein autoubiquitination
GO:0031327	0.629	negative regulation of cellular biosynthetic process
GO:0010558	0.621	negative regulation of macromolecule biosynthetic process
GO:0051253	0.605	negative regulation of RNA metabolic process
GO:1902679	0.596	negative regulation of RNA biosynthetic process
GO:0048522	0.566	positive regulation of cellular process
GO:0045892	0.504	negative regulation of DNA-templated transcription
GO:0009893	0.495	positive regulation of metabolic process
GO:0050896	0.424	response to stimulus
GO:0016574	0.382	histone ubiquitination
GO:0000122	0.367	negative regulation of transcription by RNA polymerase II
GO:0010604	0.337	positive regulation of macromolecule metabolic process
GO:0051173	0.324	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0005694	0.851	chromosome
GO:0005737	0.669	cytoplasm
GO:0000785	0.581	chromatin
GO:0032991	0.497	protein-containing complex
GO:0000792	0.319	heterochromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.997	Transferases.

[back to server]