StarFunc result for job id Q96TA1

User Input

>input (746 residues)
MGDVLSTHLDDARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLW
RKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSA
GYKILTSVDQYLELIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQ
DKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNEVQILSNL
VMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPA
MQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALMVPTSQGFTE
VRDVFFKEVTDMNLNVINEGGIDKLGEYMEKLSRLAYHPLKMQSCYEKMESLRLDGLQQR
FDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRVLERVLKKY
DYDSSSVRKRFFREALLQISIPFLLKKLAPTCKSELPRFQELIFEDFARFILVENTYEEV
VLQTVMKDILQAVKEAAVQRKHNLYRDSMVMHNSDPNLHLLAEGAPIDWGEEYSNSGGGG
SPSPSTPESATLSEKRRRAKQVVSVVQDEEVGLPFEASPESPPPASPDGVTEIRGLLAQG
LRPESPPPAGPLLNGAPAGESPQPKAAPEASSPPASPLQHLLPGKAVDLGPPKPSDQETG
EQVSSPSSHPALHTTTEDSAGVQTEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R1F1	0.868	0.864	1.888E-88	749	0.905	0.901	Q8R1F1.pdb.gz	NIBA2_MOUSE Protein Niban 2 OS=Mus musculus OX=10090 GN=Niban2 PE=1 SV=2
2	AFDB:A0A024R872	0.782	0.796	2.424E-88	733	0.976	0.993	A0A024R872.pdb.gz
3	AFDB:Q3UW53	0.723	0.587	5.057E-42	926	0.351	0.283	Q3UW53.pdb.gz	NIBA1_MOUSE Protein Niban 1 OS=Mus musculus OX=10090 GN=Niban1 PE=1 SV=2
4	AFDB:Q9BZQ8	0.728	0.591	9.842E-42	928	0.358	0.288	Q9BZQ8.pdb.gz	NIBA1_HUMAN Protein Niban 1 OS=Homo sapiens OX=9606 GN=NIBAN1 PE=1 SV=1
5	AFDB:Q9H3S7	0.073	0.039	1.412E-4	1636	0.139	0.064	Q9H3S7.pdb.gz	PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1
6	AFDB:P42331	0.130	0.149	5.811E-4	645	0.125	0.144	P42331.pdb.gz	RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens OX=9606 GN=ARHGAP25 PE=1 SV=2
7	PDB:3ljuX	0.116	0.226	2.782E-3	373	0.027	0.054	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
8	AFDB:Q7Z5H3	0.119	0.126	3.201E-3	698	0.110	0.117	Q7Z5H3.pdb.gz	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
9	AFDB:P26675	0.105	0.055	3.626E-3	1596	0.135	0.063	P26675.pdb.gz	SOS_DROME Protein son of sevenless OS=Drosophila melanogaster OX=7227 GN=Sos PE=1 SV=2
10	PDB:6s9wA	0.113	0.199	5.413E-3	411	0.029	0.054	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
11	PDB:6hhgA	0.119	0.223	6.948E-3	386	0.031	0.060	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
12	AFDB:A0A024RAF6	0.088	0.110	9.443E-3	550	0.102	0.138	A0A024RAF6.pdb.gz
13	AFDB:Q9VJJ7	0.068	0.050	1.492E-2	1128	0.111	0.074	Q9VJJ7.pdb.gz	TRPG_DROME Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2
14	PDB:6bbpA	0.115	0.163	2.323E-2	520	0.027	0.038	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
15	PDB:5kcvA	0.106	0.217	1.039E-1	353	0.027	0.057	5kcvA.pdb.gz	Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
16	PDB:2j68A	0.137	0.145	1.177E-1	680	0.105	0.115	2j68A.pdb.gz	A Bacterial Dynamin-Like Protein
17	PDB:6u3eA	0.111	0.204	2.022E-1	397	0.027	0.050	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
18	PDB:1k5dB	0.105	0.429	2.820E-1	146	0.021	0.110	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
19	PDB:7rx9A	0.109	0.180	2.820E-1	432	0.034	0.058	7rx9A.pdb.gz
20	PDB:1lw3A	0.109	0.153	3.331E-1	513	0.024	0.035	1lw3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R1F1	0.0	1386	749	0.903	0.900	NIBA2_MOUSE Protein Niban 2 OS=Mus musculus OX=10090 GN=Niban2 PE=1 SV=2
2	Q96TA1	0.0	1549	746	1.000	1.000	NIBA2_HUMAN Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3
3	Q9BZQ8	4.41e-144	447	928	0.311	0.250	NIBA1_HUMAN Protein Niban 1 OS=Homo sapiens OX=9606 GN=NIBAN1 PE=1 SV=1
4	Q3UW53	5.68e-142	442	926	0.311	0.251	NIBA1_MOUSE Protein Niban 1 OS=Mus musculus OX=10090 GN=Niban1 PE=1 SV=2
5	Q86XR2	2.02e-60	218	697	0.210	0.225	NIBA3_HUMAN Protein Niban 3 OS=Homo sapiens OX=9606 GN=NIBAN3 PE=1 SV=2
6	M9NCR4	1.1	35.4	15105	0.046	0.002	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
7	M9NER8	1.1	35.4	15638	0.046	0.002	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	M9PCJ8	1.1	35.4	14825	0.046	0.002	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PB32	1.2	35.4	19560	0.046	0.002	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PBZ4	1.2	35.4	18014	0.046	0.002	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	Q04752	1.2	34.7	461	0.035	0.056	STF1_BOVIN Steroidogenic factor 1 OS=Bos taurus OX=9913 GN=NR5A1 PE=1 SV=1
12	M9PB30	1.3	35.0	22949	0.046	0.001	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
13	M9PBZ0	1.3	35.0	22830	0.046	0.001	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PC41	1.3	35.0	22743	0.046	0.001	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PC45	1.3	35.0	22300	0.046	0.002	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	M9PEH5	1.3	35.0	20710	0.046	0.002	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PEI1	1.3	35.0	21657	0.046	0.002	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PB31	1.9	34.7	20404	0.046	0.002	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	Q9FIH8	2.2	34.3	1265	0.034	0.020	SPP_ARATH Stromal processing peptidase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SPP PE=2 SV=1
20	Q17436	2.6	33.9	727	0.051	0.052	EDG1_CAEEL Protein edg-1 OS=Caenorhabditis elegans OX=6239 GN=edg-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19011 DUF5740	2.5e+02	13.4	Family of unknown function (DUF5740)
2	PF00169 PH	2.4	20.1	PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362409

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000171111	0.870	Kelch-like ECH-associated protein 1
2	9606.ENSP00000404991	0.625	Transmembrane protein 120B
3	9606.ENSP00000399392	0.615	TPA-induced transmembrane protein
4	9606.ENSP00000305193	0.578	HCLS1-binding protein 3
5	9606.ENSP00000373565	0.537	Protein FAM83H
6	9606.ENSP00000407586	0.510	GTPase HRas
7	9606.ENSP00000256078	0.507	GTPase KRas
8	9606.ENSP00000299759	0.507	GTP-binding protein RAD
9	9606.ENSP00000379619	0.506	WD repeat-containing protein 72
10	9606.ENSP00000476313	0.505	Olfactory receptor 8G1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050839	0.523	cell adhesion molecule binding
GO:0045296	0.514	cadherin binding
GO:0003713	0.508	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0019222	0.971	regulation of metabolic process
GO:0051234	0.958	establishment of localization
GO:0065009	0.949	regulation of molecular function
GO:0140352	0.945	export from cell
GO:0032501	0.941	multicellular organismal process
GO:0080090	0.932	regulation of primary metabolic process
GO:0048522	0.932	positive regulation of cellular process
GO:0031323	0.929	regulation of cellular metabolic process
GO:0003008	0.925	system process
GO:0048523	0.925	negative regulation of cellular process
GO:0060255	0.902	regulation of macromolecule metabolic process
GO:0023052	0.900	signaling
GO:0050886	0.891	endocrine process
GO:0051171	0.844	regulation of nitrogen compound metabolic process
GO:0019219	0.664	regulation of nucleobase-containing compound metabolic process
GO:0007154	0.644	cell communication
GO:0010468	0.615	regulation of gene expression
GO:0031325	0.609	positive regulation of cellular metabolic process
GO:0051173	0.608	positive regulation of nitrogen compound metabolic process
GO:0010604	0.602	positive regulation of macromolecule metabolic process
GO:0010556	0.546	regulation of macromolecule biosynthetic process
GO:0031326	0.546	regulation of cellular biosynthetic process
GO:0009892	0.540	negative regulation of metabolic process
GO:0051252	0.540	regulation of RNA metabolic process
GO:0045934	0.521	negative regulation of nucleobase-containing compound metabolic process
GO:0051052	0.485	regulation of DNA metabolic process
GO:0031327	0.475	negative regulation of cellular biosynthetic process
GO:0032940	0.467	secretion by cell
GO:0050896	0.464	response to stimulus
GO:0044093	0.463	positive regulation of molecular function
GO:0006355	0.463	regulation of DNA-templated transcription
GO:0065008	0.460	regulation of biological quality
GO:0010558	0.426	negative regulation of macromolecule biosynthetic process
GO:0051053	0.415	negative regulation of DNA metabolic process
GO:0045935	0.408	positive regulation of nucleobase-containing compound metabolic process
GO:2000278	0.405	regulation of DNA biosynthetic process
GO:0051099	0.391	positive regulation of binding
GO:0051254	0.390	positive regulation of RNA metabolic process
GO:0045893	0.381	positive regulation of DNA-templated transcription
GO:0010817	0.375	regulation of hormone levels
GO:0023061	0.364	signal release
GO:0009914	0.356	hormone transport
GO:0046879	0.353	hormone secretion
GO:0045892	0.335	negative regulation of DNA-templated transcription
GO:0060548	0.325	negative regulation of cell death
GO:0043066	0.322	negative regulation of apoptotic process
GO:2000279	0.322	negative regulation of DNA biosynthetic process
GO:0042127	0.317	regulation of cell population proliferation
GO:0051716	0.316	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.997	membrane
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0071944	0.996	cell periphery
GO:0070013	0.996	intracellular organelle lumen
GO:0005886	0.994	plasma membrane
GO:0005654	0.990	nucleoplasm
GO:0005576	0.700	extracellular region
GO:0070062	0.580	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]