StarFunc result for job id Q96TA2

User Input

>input (773 residues)
MFSLSSTVQPQVTVPLSHLINAFHTPKNTSVSLSGVSVSQNQHRDVVPEHEAPSSECMFS
DFLTKLNIVSIGKGKIFEGYRSMFMEPAKRMKKSLDTTDNWHIRPEPFSLSIPPSLNLRD
LGLSELKIGQIDQLVENLLPGFCKGKNISSHWHTSHVSAQSFFENKYGNLDIFSTLRSSC
LYRHHSRALQSICSDLQYWPVFIQSRGFKTLKSRTRRLQSTSERLAETQNIAPSFVKGFL
LRDRGSDVESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQALTQKTNDSLRRTRLILFVL
LLFGIYGLLKNPFLSVRFRTTTGLDSAVDPVQMKNVTFEHVKGVEEAKQELQEVVEFLKN
PQKFTILGGKLPKGILLVGPPGTGKTLLARAVAGEADVPFYYASGSEFDEMFVGVGASRI
RNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYSRQTINQLLAEMDGFKPNEGVIIIG
ATNFPEALDNALIRPGRFDMQVTVPRPDVKGRTEILKWYLNKIKFDQSVDPEIIARGTVG
FSGAELENLVNQAALKAAVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHE
SGHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQMDVSMGGRVA
EELIFGTDHITTGASSDFDNATKIAKRMVTKFGMSEKLGVMTYSDTGKLSPETQSAIEQE
IRILLRDSYERAKHILKTHAKEHKNLAEALLTYETLDAKEIQIVLEGKKLEVR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96TA2	1.000	1.000	0.000	773	1.000	1.000	Q96TA2.pdb.gz	YMEL1_HUMAN ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens OX=9606 GN=YME1L1 PE=1 SV=2
2	AFDB:F3YDF1	0.572	0.597	1.350E-62	740	0.427	0.446	F3YDF1.pdb.gz	YMEL1_DROME ATP-dependent zinc metalloprotease YME1L OS=Drosophila melanogaster OX=7227 GN=YME1L PE=2 SV=1
3	AFDB:O80983	0.571	0.614	2.114E-59	717	0.344	0.371	O80983.pdb.gz	FTSH4_ARATH ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH4 PE=1 SV=2
4	AFDB:P32795	0.559	0.577	9.751E-58	747	0.356	0.368	P32795.pdb.gz	YME1_YEAST Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YME1 PE=1 SV=1
5	AFDB:O59824	0.569	0.620	1.462E-56	709	0.340	0.371	O59824.pdb.gz	YME1_SCHPO ATP-dependent zinc metalloprotease YME1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC965.04c PE=3 SV=1
6	AFDB:P0AAI3	0.571	0.683	2.679E-54	644	0.307	0.368	P0AAI3.pdb.gz	FTSH_ECOLI ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli (strain K12) OX=83333 GN=ftsH PE=1 SV=1
7	AFDB:Q9HV48	0.570	0.687	4.242E-54	639	0.294	0.355	Q9HV48.pdb.gz	Q9HV48_PSEAE ATP-dependent zinc metalloprotease FtsH OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=ftsH PE=3 SV=1
8	AFDB:P37476	0.553	0.667	8.610E-52	637	0.303	0.367	P37476.pdb.gz	FTSH_BACSU ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) OX=224308 GN=ftsH PE=1 SV=1
9	AFDB:Q8I526	0.546	0.482	2.052E-51	880	0.304	0.267	Q8I526.pdb.gz	Q8I526_PLAF7 ATP-dependent zinc metalloprotease FTSH 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1239700 PE=3 SV=1
10	AFDB:Q9WZ49	0.550	0.693	6.313E-51	610	0.283	0.359	Q9WZ49.pdb.gz	FTSH_THEMA ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=ftsH PE=1 SV=1
11	PDB:7tdoA	0.514	0.922	1.309E-42	420	0.273	0.502	7tdoA.pdb.gz	Cryo-EM structure of transmembrane AAA+ protease FtsH in the ADP state.
12	PDB:7wi4A	0.482	0.886	1.270E-34	410	0.259	0.488	7wi4A.pdb.gz	Cryo-EM structure of the entire FtsH-HflKC AAA protease complex.
13	PDB:7ln6F	0.299	0.323	1.639E-20	714	0.133	0.144	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
14	PDB:5l4gL	0.304	0.590	2.115E-20	389	0.120	0.239	5l4gL.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
15	PDB:5l4gM	0.315	0.575	2.343E-20	415	0.120	0.224	5l4gM.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
16	PDB:5ifwB	0.290	0.319	7.209E-20	702	0.127	0.140	5ifwB.pdb.gz	Quantitative interaction mapping reveals an extended UBX domain in ASPL that disrupts functional p97 hexamers.
17	PDB:5mp9L	0.317	0.616	9.307E-20	388	0.131	0.260	5mp9L.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
18	PDB:5mp9I	0.314	0.613	1.632E-19	385	0.115	0.231	5mp9I.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
19	PDB:7vcsA	0.298	0.301	2.108E-19	766	0.129	0.131	7vcsA.pdb.gz	Cryo-EM structures of human p97 double hexamer capture potentiated ATPase-competent state.
20	PDB:5mp9M	0.322	0.636	2.721E-19	381	0.120	0.244	5mp9M.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KFY4	0.0	597	739	0.404	0.422	A0A0B4KFY4_DROME YME1 like ATPase, isoform D OS=Drosophila melanogaster OX=7227 GN=YME1L PE=1 SV=1
2	F3YDF1	0.0	593	740	0.404	0.422	YMEL1_DROME ATP-dependent zinc metalloprotease YME1L OS=Drosophila melanogaster OX=7227 GN=YME1L PE=2 SV=1
3	O88967	0.0	1349	715	0.871	0.941	YMEL1_MOUSE ATP-dependent zinc metalloprotease YME1L1 OS=Mus musculus OX=10090 GN=Yme1l1 PE=1 SV=1
4	Q96I63	0.0	1535	740	0.956	0.999	Q96I63_HUMAN YME1-like 1 (S. cerevisiae) OS=Homo sapiens OX=9606 GN=YME1L1 PE=1 SV=1
5	Q96TA2	0.0	1601	773	1.000	1.000	YMEL1_HUMAN ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens OX=9606 GN=YME1L1 PE=1 SV=2
6	O80983	8.42e-176	523	717	0.335	0.361	FTSH4_ARATH ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH4 PE=1 SV=2
7	Q9FGM0	3.30e-171	514	806	0.331	0.318	FTSHB_ARATH ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=FTSH11 PE=1 SV=1
8	O59824	1.69e-163	491	709	0.321	0.350	YME1_SCHPO ATP-dependent zinc metalloprotease YME1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC965.04c PE=3 SV=1
9	P32795	2.03e-157	477	747	0.320	0.331	YME1_YEAST Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YME1 PE=1 SV=1
10	Q38AK2	4.18e-156	471	657	0.308	0.362	Q38AK2_TRYB2 Mitochondrial ATP-dependent zinc metallopeptidase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3030 PE=3 SV=1
11	Q9HV48	4.64e-148	449	639	0.287	0.347	Q9HV48_PSEAE ATP-dependent zinc metalloprotease FtsH OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=ftsH PE=3 SV=1
12	P0AAI3	4.56e-146	444	644	0.288	0.346	FTSH_ECOLI ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli (strain K12) OX=83333 GN=ftsH PE=1 SV=1
13	P37476	2.15e-141	432	637	0.291	0.353	FTSH_BACSU ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) OX=224308 GN=ftsH PE=1 SV=1
14	Q9WZ49	2.83e-139	426	610	0.287	0.364	FTSH_THEMA ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=ftsH PE=1 SV=1
15	Q8I526	9.13e-137	427	880	0.283	0.249	Q8I526_PLAF7 ATP-dependent zinc metalloprotease FTSH 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1239700 PE=3 SV=1
16	Q9FH02	2.09e-129	403	704	0.273	0.300	FTSH5_ARATH ATP-dependent zinc metalloprotease FTSH 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSH5 PE=1 SV=1
17	Q55700	2.22e-129	400	627	0.277	0.341	FTSH2_SYNY3 ATP-dependent zinc metalloprotease FtsH 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=ftsH2 PE=1 SV=1
18	Q39102	6.78e-129	402	716	0.268	0.289	FTSH1_ARATH ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSH1 PE=1 SV=2
19	Q8W585	7.42e-128	399	685	0.273	0.308	FTSH8_ARATH ATP-dependent zinc metalloprotease FTSH 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSH8 PE=1 SV=1
20	O80860	1.35e-126	395	695	0.270	0.301	FTSH2_ARATH ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSH2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	3.5e-38	142.4	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	0.2	23.5	AAA ATPase domain
3	PF13207 AAA_17	71	15.3	AAA domain
4	PF13238 AAA_18	2.1e+02	13.8	AAA domain
5	PF07724 AAA_2	69	15.0	AAA domain (Cdc48 subfamily)
6	PF13401 AAA_22	2.3	20.0	AAA domain
7	PF13481 AAA_25	4.5e+02	11.8	AAA domain
8	PF13521 AAA_28	4.1e+02	12.6	AAA domain
9	PF13671 AAA_33	70	15.0	AAA domain
10	PF07728 AAA_5	1.7	20.1	AAA domain (dynein-related subfamily)
11	PF12775 AAA_7	3.8e+02	12.0	P-loop containing dynein motor region
12	PF17862 AAA_lid_3	7.1e-05	33.9	AAA+ lid domain
13	PF05673 DUF815	50	14.5	Protein of unknown function (DUF815)
14	PF10415 FumaraseC_C	1.9e+02	13.9	Fumarase C C-terminus
15	PF01695 IstB_IS21	62	14.5	IstB-like ATP binding protein
16	PF01078 Mg_chelatase	59	14.5	Magnesium chelatase, subunit ChlI
17	PF01434 Peptidase_M41	1.1e-61	219.6	Peptidase family M41
18	PF05496 RuvB_N	1.6	19.9	Holliday junction DNA helicase RuvB P-loop domain
19	PF06068 TIP49	0.8	20.5	TIP49 P-loop domain
20	PF06414 Zeta_toxin	96	13.8	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318480

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325421	0.957	Presenilins-associated rhomboid-like protein, mitochondrial
2	9606.ENSP00000360270	0.939	Metalloendopeptidase OMA1, mitochondrial
3	9606.ENSP00000300107	0.933	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial
4	9606.ENSP00000423673	0.924	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
5	9606.ENSP00000327467	0.915	Essential MCU regulator, mitochondrial
6	9606.ENSP00000418803	0.913	Complex I assembly factor TIMMDC1, mitochondrial
7	9606.ENSP00000381736	0.906	ATP synthase subunit alpha, mitochondrial
8	9606.ENSP00000353826	0.886	Lon protease homolog, mitochondrial
9	9606.ENSP00000245816	0.885	ATP-dependent Clp protease proteolytic subunit, mitochondrial
10	9606.ENSP00000373620	0.882	60 kDa heat shock protein, mitochondrial
11	9606.ENSP00000449089	0.839	Dynamin-1-like protein
12	9606.ENSP00000479488	0.836	Prohibitin
13	9606.ENSP00000441875	0.816	Prohibitin-2
14	9606.ENSP00000294053	0.798	Caseinolytic peptidase B protein homolog
15	9606.ENSP00000356256	0.791	Mitochondrial import inner membrane translocase subunit Tim17-A
16	9606.ENSP00000348886	0.766	Stomatin-like protein 2, mitochondrial
17	9606.ENSP00000264954	0.761	GrpE protein homolog 1, mitochondrial
18	9606.ENSP00000378588	0.752	Mitochondrial import inner membrane translocase subunit Tim9
19	9606.ENSP00000483491	0.741	Mitochondrial inner membrane protein OXA1L
20	9606.ENSP00000226299	0.735	Cytosol aminopeptidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004176	0.999	ATP-dependent peptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.998	metabolic process
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.974	primary metabolic process
GO:0009987	0.968	cellular process
GO:0006807	0.965	nitrogen compound metabolic process
GO:0006508	0.921	proteolysis
GO:0016485	0.802	protein processing
GO:0071840	0.559	cellular component organization or biogenesis
GO:0044237	0.524	cellular metabolic process
GO:0016043	0.495	cellular component organization
GO:0065007	0.346	biological regulation
GO:0050789	0.304	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.996	intracellular organelle lumen
GO:0031981	0.991	nuclear lumen
GO:0016020	0.979	membrane
GO:0005654	0.961	nucleoplasm
GO:0031090	0.790	organelle membrane
GO:0031975	0.755	envelope
GO:0031967	0.753	organelle envelope
GO:0019866	0.687	organelle inner membrane
GO:0005740	0.681	mitochondrial envelope
GO:0005743	0.524	mitochondrial inner membrane
GO:0032991	0.369	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]