StarFunc result for job id Q99075

User Input

>input (208 residues)
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99075	1.000	1.000	4.462E-34	208	1.000	1.000	Q99075.pdb.gz	HBEGF_HUMAN Proheparin-binding EGF-like growth factor OS=Homo sapiens OX=9606 GN=HBEGF PE=1 SV=1
2	AFDB:Q06175	0.721	0.721	1.260E-27	208	0.817	0.817	Q06175.pdb.gz	HBEGF_RAT Proheparin-binding EGF-like growth factor OS=Rattus norvegicus OX=10116 GN=Hbegf PE=2 SV=1
3	AFDB:Q9W7C5	0.554	0.545	1.678E-17	212	0.543	0.533	Q9W7C5.pdb.gz	HBEGF_CHICK Proheparin-binding EGF-like growth factor OS=Gallus gallus OX=9031 GN=HBEGF PE=1 SV=1
4	AFDB:Q6NY79	0.415	0.368	4.268E-12	239	0.404	0.351	Q6NY79.pdb.gz
5	AFDB:A9JRW9	0.273	0.251	7.926E-12	230	0.389	0.352	A9JRW9.pdb.gz	A9JRW9_DANRE Heparin-binding EGF-like growth factor a OS=Danio rerio OX=7955 GN=hbegfa PE=2 SV=1
6	AFDB:P24338	0.258	0.234	7.173E-9	243	0.341	0.292	P24338.pdb.gz	AREG_RAT Amphiregulin OS=Rattus norvegicus OX=10116 GN=Areg PE=1 SV=1
7	AFDB:P31955	0.303	0.263	2.473E-8	248	0.317	0.266	P31955.pdb.gz	AREG_MOUSE Amphiregulin OS=Mus musculus OX=10090 GN=Areg PE=2 SV=1
8	AFDB:P15514	0.333	0.288	3.488E-8	252	0.269	0.222	P15514.pdb.gz	AREG_HUMAN Amphiregulin OS=Homo sapiens OX=9606 GN=AREG PE=1 SV=2
9	AFDB:Q64EU6	0.241	0.285	1.532E-6	171	0.159	0.193	Q64EU6.pdb.gz	Q64EU6_CHICK Betacellulin OS=Gallus gallus OX=9031 GN=BTC PE=2 SV=1
10	AFDB:Q6UW88	0.311	0.404	1.883E-6	154	0.154	0.208	Q6UW88.pdb.gz	EPGN_HUMAN Epigen OS=Homo sapiens OX=9606 GN=EPGN PE=1 SV=2
11	PDB:4rs0A	0.176	0.071	1.648E-1	557	0.058	0.022	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
12	PDB:3t5oA	0.173	0.044	3.512E-1	871	0.058	0.014	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
13	PDB:7q3nU	0.152	0.114	4.030E-1	292	0.062	0.045	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
14	PDB:5es4B	0.088	0.028	1.055	674	0.034	0.010	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
15	PDB:4e0sB	0.173	0.043	1.297	898	0.058	0.013	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
16	PDB:6h03C	0.132	0.059	1.488	513	0.043	0.018	6h03C.pdb.gz
17	PDB:7nycD	0.128	0.057	1.488	487	0.043	0.018	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:2hoxD	0.144	0.077	1.594	427	0.048	0.023	2hoxD.pdb.gz	Two Structures of Alliinase from Alliium sativum L.: Apo Form and Ternary Complex with Aminoacrylate Reaction Intermediate Covalently Bound to the PLP Cofactor.
19	PDB:7nycC	0.143	0.039	1.594	809	0.048	0.012	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:2pe4A	0.089	0.049	1.960	417	0.038	0.019	2pe4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99075	1.83e-151	420	208	1.000	1.000	HBEGF_HUMAN Proheparin-binding EGF-like growth factor OS=Homo sapiens OX=9606 GN=HBEGF PE=1 SV=1
2	Q06175	4.02e-101	293	208	0.817	0.817	HBEGF_RAT Proheparin-binding EGF-like growth factor OS=Rattus norvegicus OX=10116 GN=Hbegf PE=2 SV=1
3	Q06186	5.06e-101	292	208	0.808	0.808	HBEGF_MOUSE Proheparin-binding EGF-like growth factor OS=Mus musculus OX=10090 GN=Hbegf PE=2 SV=1
4	Q9W7C5	2.67e-70	215	212	0.486	0.476	HBEGF_CHICK Proheparin-binding EGF-like growth factor OS=Gallus gallus OX=9031 GN=HBEGF PE=1 SV=1
5	A9JRW9	7.02e-42	143	230	0.308	0.278	A9JRW9_DANRE Heparin-binding EGF-like growth factor a OS=Danio rerio OX=7955 GN=hbegfa PE=2 SV=1
6	P15514	1.12e-13	69.7	252	0.188	0.155	AREG_HUMAN Amphiregulin OS=Homo sapiens OX=9606 GN=AREG PE=1 SV=2
7	P31955	7.15e-12	64.7	248	0.188	0.157	AREG_MOUSE Amphiregulin OS=Mus musculus OX=10090 GN=Areg PE=2 SV=1
8	P24338	3.01e-10	60.1	243	0.120	0.103	AREG_RAT Amphiregulin OS=Rattus norvegicus OX=10116 GN=Areg PE=1 SV=1
9	A0A8J8YRH0	9.82e-09	55.1	191	0.120	0.131	A0A8J8YRH0_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
10	A0A8I6AQ55	1.05e-08	55.1	199	0.120	0.126	A0A8I6AQ55_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
11	Q9JJM4	1.60e-08	54.3	177	0.120	0.141	Q9JJM4_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=2 SV=1
12	A0A8I5ZSF9	2.94e-08	53.9	193	0.120	0.130	A0A8I5ZSF9_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
13	Q05928	1.46e-07	51.6	177	0.096	0.113	BTC_MOUSE Probetacellulin OS=Mus musculus OX=10090 GN=Btc PE=1 SV=1
14	P35070	2.74e-06	48.1	178	0.115	0.135	BTC_HUMAN Probetacellulin OS=Homo sapiens OX=9606 GN=BTC PE=1 SV=1
15	P01135	5.18e-06	47.0	160	0.130	0.169	TGFA_HUMAN Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1
16	Q9UIK5	5.67e-06	48.1	374	0.154	0.086	TEFF2_HUMAN Tomoregulin-2 OS=Homo sapiens OX=9606 GN=TMEFF2 PE=1 SV=1
17	Q924X1	1.43e-05	45.8	152	0.091	0.125	EPGN_MOUSE Epigen OS=Mus musculus OX=10090 GN=Epgn PE=2 SV=1
18	Q6J1M9	2.32e-05	45.1	156	0.101	0.135	Q6J1M9_CHICK Transforming growth factor alpha OS=Gallus gallus OX=9031 PE=2 SV=1
19	P48030	2.85e-05	45.1	159	0.125	0.164	TGFA_MOUSE Protransforming growth factor alpha OS=Mus musculus OX=10090 GN=Tgfa PE=1 SV=1
20	P01134	3.75e-05	44.7	159	0.125	0.164	TGFA_RAT Protransforming growth factor alpha OS=Rattus norvegicus OX=10116 GN=Tgfa PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	0.25	23.0	EGF-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000230990

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
2	9606.ENSP00000342235	0.999	Receptor tyrosine-protein kinase erbB-4
3	9606.ENSP00000371958	0.987	CD9 antigen
4	9606.ENSP00000269571	0.970	Receptor tyrosine-protein kinase erbB-2
5	9606.ENSP00000309968	0.968	Disintegrin and metalloproteinase domain-containing protein 17
6	9606.ENSP00000260227	0.961	Matrilysin
7	9606.ENSP00000302665	0.961	Insulin-like growth factor I
8	9606.ENSP00000306245	0.958	Proto-oncogene c-Fos
9	9606.ENSP00000361405	0.950	Matrix metalloproteinase-9
10	9606.ENSP00000398632	0.948	CD44 antigen
11	9606.ENSP00000219070	0.944	72 kDa type IV collagenase
12	9606.ENSP00000249075	0.944	Leukemia inhibitory factor
13	9606.ENSP00000299855	0.941	Stromelysin-1
14	9606.ENSP00000256078	0.940	GTPase KRas
15	9606.ENSP00000407586	0.939	GTPase HRas
16	9606.ENSP00000401303	0.938	SHC-transforming protein 1
17	9606.ENSP00000268035	0.937	Insulin-like growth factor 1 receptor
18	9606.ENSP00000376345	0.935	Growth factor receptor-bound protein 2
19	9606.ENSP00000437955	0.934	Hypoxia-inducible factor 1-alpha
20	9606.ENSP00000302150	0.929	Prolactin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0097367	1.000	carbohydrate derivative binding
GO:0005154	1.000	epidermal growth factor receptor binding
GO:0008083	1.000	growth factor activity
GO:0030297	1.000	transmembrane receptor protein tyrosine kinase activator activity
GO:0008201	0.989	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007165	0.986	signal transduction
GO:0032501	0.973	multicellular organismal process
GO:0048522	0.971	positive regulation of cellular process
GO:0007166	0.941	cell surface receptor signaling pathway
GO:0048856	0.935	anatomical structure development
GO:0007167	0.932	enzyme-linked receptor protein signaling pathway
GO:0007169	0.918	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0019222	0.814	regulation of metabolic process
GO:0048583	0.812	regulation of response to stimulus
GO:0038127	0.806	ERBB signaling pathway
GO:0060255	0.791	regulation of macromolecule metabolic process
GO:0007173	0.761	epidermal growth factor receptor signaling pathway
GO:0007275	0.759	multicellular organism development
GO:0051171	0.735	regulation of nitrogen compound metabolic process
GO:0080090	0.734	regulation of primary metabolic process
GO:0031323	0.704	regulation of cellular metabolic process
GO:0048519	0.571	negative regulation of biological process
GO:0030335	0.545	positive regulation of cell migration
GO:0009966	0.521	regulation of signal transduction
GO:0051246	0.514	regulation of protein metabolic process
GO:0048584	0.512	positive regulation of response to stimulus
GO:0009967	0.486	positive regulation of signal transduction
GO:0009893	0.462	positive regulation of metabolic process
GO:0048523	0.457	negative regulation of cellular process
GO:0042221	0.451	response to chemical
GO:1902533	0.435	positive regulation of intracellular signal transduction
GO:0010604	0.434	positive regulation of macromolecule metabolic process
GO:0031325	0.413	positive regulation of cellular metabolic process
GO:0051173	0.411	positive regulation of nitrogen compound metabolic process
GO:0016477	0.406	cell migration
GO:0031399	0.394	regulation of protein modification process
GO:0051239	0.392	regulation of multicellular organismal process
GO:0042127	0.389	regulation of cell population proliferation
GO:0080134	0.369	regulation of response to stress
GO:0019220	0.369	regulation of phosphate metabolic process
GO:0006950	0.362	response to stress
GO:0008284	0.349	positive regulation of cell population proliferation
GO:0070887	0.343	cellular response to chemical stimulus
GO:0042327	0.324	positive regulation of phosphorylation
GO:0001932	0.317	regulation of protein phosphorylation
GO:0031401	0.306	positive regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005886	1.000	plasma membrane
GO:0005737	0.991	cytoplasm
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0031982	0.966	vesicle
GO:0031090	0.959	organelle membrane
GO:0031410	0.956	cytoplasmic vesicle
GO:0098588	0.935	bounding membrane of organelle
GO:0030659	0.875	cytoplasmic vesicle membrane
GO:0009986	0.664	cell surface
GO:0030662	0.659	coated vesicle membrane
GO:0012505	0.652	endomembrane system
GO:0030666	0.651	endocytic vesicle membrane
GO:0030136	0.588	clathrin-coated vesicle
GO:0030665	0.577	clathrin-coated vesicle membrane
GO:0030669	0.573	clathrin-coated endocytic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]