StarFunc result for job id Q99102

User Input

>input (2169 residues)
MKGARWRRVPWVSLSCLCLCLLPHVVPGTTEDTLITGSKTAAPVTSTGSTTATLEGQSTA
ASSRTSNQDISASSQNHQTKSTETTSKAQTDTLTQMMTSTLFSSPSVHNVMETVTQETAP
PDEMTTSFPSSVTNTLMMTSKTITMTTSTDSTLGNTEETSTAGTESSTPVTSAVSITAGQ
EGQSRTTSWRTSIQDTSASSQNHWTRSTQTTRESQTSTLTHRTTSTPSFSPSVHNVTGTV
SQKTSPSGETATSSLCSVTNTSMMTSEKITVTTSTGSTLGNPGETSSVPVTGSLMPVTSA
ALVTVDPEGQSPATFSRTSTQDTTAFSKNHQTQSVETTRVSQINTLNTLTPVTTSTVLSS
PSGFNPSGTVSQETFPSGETTISSPSSVSNTFLVTSKVFRMPISRDSTLGNTEETSLSVS
GTISAITSKVSTIWWSDTLSTALSPSSLPPKISTAFHTQQSEGAETTGRPHERSSFSPGV
SQEIFTLHETTTWPSSFSSKGHTTWSQTELPSTSTGAATRLVTGNPSTRAAGTIPRVPSK
VSAIGEPGEPTTYSSHSTTLPKTTGAGAQTQWTQETGTTGEALLSSPSYSVIQMIKTATS
PSSSPMLDRHTSQQITTAPSTNHSTIHSTSTSPQESPAVSQRGHTRAPQTTQESQTTRSV
SPMTDTKTVTTPGSSFTASGHSPSEIVPQDAPTISAATTFAPAPTGNGHTTQAPTTALQA
APSSHDATLGPSGGTSLSKTGALTLANSVVSTPGGPEGQWTSASASTSPDTAAAMTHTHQ
AESTEASGQTQTSEPASSGSRTTSAGTATPSSSGASGTTPSGSEGISTSGETTRFSSNPS
RDSHTTQSTTELLSASASHGAIPVSTGMASSIVPGTFHPTLSEASTAGRPTGQSSPTSPS
ASPQETAAISRMAQTQRTGTSRGSDTISLASQATDTFSTVPPTPPSITSSGLTSPQTQTH
TLSPSGSGKTFTTALISNATPLPVTSTSSASTGHATPLAVSSATSASTVSSDSPLKMETS
GMTTPSLKTDGGRRTATSPPPTTSQTIISTIPSTAMHTRSTAAPIPILPERGVSLFPYGA
GAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDNGQIIFPESDYQIFSYPNPLP
TGFTGRDPVALVAPFWDDADFSTGRGTTFYQEYETFYGEHSLLVQQAESWIRKMTNNGGY
KARWALKVTWVNAHAYPAQWTLGSNTYQAILSTDGSRSYALFLYQSGGMQWDVAQRSGNP
VLMGFSSGDGYFENSPLMSQPVWERYRPDRFLNSNSGLQGLQFYRLHREERPNYRLECLQ
WLKSQPRWPSWGWNQVSCPCSWQQGRRDLRFQPVSIGRWGLGSRQLCSFTSWRGGVCCSY
GPWGEFREGWHVQRPWQLAQELEPQSWCCRWNDKPYLCALYQQRRPHVGCATYRPPQPAW
MFGDPHITTLDGVSYTFNGLGDFLLVGAQDGNSSFLLQGRTAQTGSAQATNFIAFAAQYR
SSSLGPVTVQWLLEPHDAIRVLLDNQTVTFQPDHEDGGGQETFNATGVLLSRNGSEVSAS
FDGWATVSVIALSNILHASASLPPEYQNRTEGLLGVWNNNPEDDFRMPNGSTIPPGSPEE
MLFHFGMTWQINGTGLLGKRNDQLPSNFTPVFYSQLQKNSSWAEHLISNCDGDSSCIYDT
LALRNASIGLHTREVSKNYEQANATLNQYPPSINGGRVIEAYKGQTTLIQYTSNAEDANF
TLRDSCTDLELFENGTLLWTPKSLEPFTLEILARSAKIGLASALQPRTVVCHCNAESQCL
YNQTSRVGNSSLEVAGCKCDGGTFGRYCEGSEDACEEPCFPSVHCVPGKGCEACPPNLTG
DGRHCAALGSSFLCQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNF
SPTVNLELPLRVIQLLLSEEENASMAEVNASVAYRLGTLDMRAFLRNSQVERIDSAAPAS
GSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAVVEAFLYHVPRRSEEPRNDVVFQPISGE
DVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQSGFTCVSPCSRGYCDHGGQCQHLPSGPR
CSCVSFSIYTAWGEHCEHLSMKLDAFFGIFFGALGGLLLLGVGTFVVLRFWGCSGARFSY
FLNSAEALP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99102	1.000	1.000	0.000	2169	1.000	1.000	Q99102.pdb.gz	MUC4_HUMAN Mucin-4 OS=Homo sapiens OX=9606 GN=MUC4 PE=1 SV=5
2	AFDB:A0A1F4	0.043	0.043	4.992E-5	2176	0.117	0.117	A0A1F4.pdb.gz	EYS_DROME Protein eyes shut OS=Drosophila melanogaster OX=7227 GN=eys PE=1 SV=1
3	PDB:6z3mc	0.058	0.631	5.848E-5	158	0.012	0.158	6z3mc.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
4	AFDB:B7YZW3	0.033	0.034	1.785E-3	2064	0.104	0.109	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
5	PDB:6xt9I	0.041	0.099	2.202E-3	767	0.026	0.073	6xt9I.pdb.gz
6	AFDB:E7F5U2	0.037	0.033	3.324E-3	2497	0.102	0.089	E7F5U2.pdb.gz
7	PDB:5ngjA	0.047	0.173	3.333E-3	440	0.015	0.073	5ngjA.pdb.gz
8	PDB:6mp0A	0.043	0.120	6.540E-3	388	0.023	0.126	6mp0A.pdb.gz
9	PDB:2mm3A	0.027	0.219	7.640E-3	127	0.007	0.126	2mm3A.pdb.gz	Structural determinants of ligand binding in the ternary complex of human ileal bile acid binding protein with glycocholate and glycochenodeoxycholate obtained from solution NMR
10	PDB:2p4bB	0.031	0.152	8.046E-3	260	0.017	0.138	2p4bB.pdb.gz
11	AFDB:E9Q4Y4	0.053	0.051	8.901E-3	2514	0.117	0.101	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
12	PDB:3ve1A	0.037	0.107	9.900E-3	537	0.020	0.080	3ve1A.pdb.gz	The structural basis of transferrin sequestration by transferrin-binding protein B.
13	PDB:2qo5A	0.028	0.239	1.098E-2	129	0.006	0.093	2qo5A.pdb.gz
14	PDB:3rfzB	0.030	0.057	1.098E-2	778	0.040	0.111	3rfzB.pdb.gz
15	PDB:3wjeB	0.037	0.276	1.157E-2	154	0.009	0.123	3wjeB.pdb.gz
16	AFDB:Q8TEP8	0.042	0.039	1.215E-2	2537	0.102	0.087	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
17	AFDB:Q54NE5	0.038	0.043	1.347E-2	1918	0.098	0.111	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
18	AFDB:O88466	0.041	0.044	3.608E-2	1888	0.105	0.121	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
19	AFDB:Q04164	0.037	0.042	7.851E-2	1693	0.102	0.131	Q04164.pdb.gz	SAS_DROME Putative epidermal cell surface receptor OS=Drosophila melanogaster OX=7227 GN=sas PE=2 SV=2
20	AFDB:Q3U0P1	0.034	0.055	1.017E-1	1104	0.065	0.127	Q3U0P1.pdb.gz	PALB2_MOUSE Partner and localizer of BRCA2 OS=Mus musculus OX=10090 GN=Palb2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63661	0.0	1118	2344	0.283	0.262	MUC4_RAT Mucin-4 OS=Rattus norvegicus OX=10116 GN=Muc4 PE=1 SV=2
2	Q8JZM8	0.0	1634	3470	0.345	0.216	MUC4_MOUSE Mucin-4 OS=Mus musculus OX=10090 GN=Muc4 PE=2 SV=2
3	Q99102	0.0	1754	5412	0.454	0.182	MUC4_HUMAN Mucin-4 OS=Homo sapiens OX=9606 GN=MUC4 PE=1 SV=5
4	A0A140VJW3	1.50e-30	134	822	0.049	0.129	A0A140VJW3_HUMAN Sushi domain containing 2, isoform CRA_a OS=Homo sapiens OX=9606 GN=SUSD2 PE=2 SV=1
5	Q9UGT4	1.50e-30	134	822	0.049	0.129	SUSD2_HUMAN Sushi domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUSD2 PE=1 SV=1
6	Q0KHY3	4.47e-28	127	1454	0.049	0.073	MESH_DROME Protein mesh OS=Drosophila melanogaster OX=7227 GN=mesh PE=1 SV=2
7	P14543	2.25e-11	72.0	1247	0.036	0.063	NID1_HUMAN Nidogen-1 OS=Homo sapiens OX=9606 GN=NID1 PE=1 SV=3
8	Q14112	3.05e-10	68.6	1375	0.033	0.052	NID2_HUMAN Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=3
9	P10493	3.52e-10	68.2	1245	0.029	0.051	NID1_MOUSE Nidogen-1 OS=Mus musculus OX=10090 GN=Nid1 PE=1 SV=2
10	F1RGY5	1.71e-09	65.9	1309	0.029	0.047	F1RGY5_PIG Nidogen 1 OS=Sus scrofa OX=9823 GN=NID1 PE=1 SV=4
11	M9PCE5	1.33e-08	63.2	3842	0.030	0.017	M9PCE5_DROME Hemolectin, isoform B OS=Drosophila melanogaster OX=7227 GN=Hml PE=1 SV=1
12	Q9VU94	1.50e-08	63.2	3843	0.030	0.017	Q9VU94_DROME Hemolectin, isoform A OS=Drosophila melanogaster OX=7227 GN=Hml PE=1 SV=2
13	Q9U5D0	1.54e-08	63.2	3843	0.030	0.017	Q9U5D0_DROME Hemolectin OS=Drosophila melanogaster OX=7227 GN=Hml PE=2 SV=1
14	A0A4X1WD80	2.93e-08	62.0	1348	0.030	0.048	A0A4X1WD80_PIG Nidogen 2 OS=Sus scrofa OX=9823 GN=NID2 PE=4 SV=1
15	Q70E20	9.78e-08	60.1	1403	0.024	0.038	SNED1_MOUSE Sushi, nidogen and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sned1 PE=2 SV=2
16	Q8TER0	2.60e-07	58.9	1413	0.026	0.040	SNED1_HUMAN Sushi, nidogen and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNED1 PE=1 SV=2
17	E9Q9C6	2.72e-07	58.9	2583	0.022	0.018	E9Q9C6_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
18	O88322	3.43e-07	58.5	1403	0.027	0.041	NID2_MOUSE Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV=2
19	O75443	4.81e-07	58.2	2155	0.024	0.024	TECTA_HUMAN Alpha-tectorin OS=Homo sapiens OX=9606 GN=TECTA PE=1 SV=3
20	E9Q0B5	5.70e-07	57.8	2583	0.022	0.018	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06119 NIDO	9.5e-12	56.9	Nidogen-like
2	PF00094 VWD	2.6e-18	78.3	von Willebrand factor type D domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9483.ENSCJAP00000030256

Rank	PPI partner	STRING score	Description
1	9483.ENSCJAP00000022325	0.938	Mucin 5B, oligomeric mucus/gel-forming
2	9483.ENSCJAP00000021301	0.925	Mucin 6, oligomeric mucus/gel-forming
3	9483.ENSCJAP00000030278	0.907	Mucin 20, cell surface associated
4	9483.ENSCJAP00000012286	0.903	Mucin 13, cell surface associated
5	9483.ENSCJAP00000016267	0.903	Receptor protein-tyrosine kinase
6	9483.ENSCJAP00000016332	0.903	Mucin 1, cell surface associated
7	9483.ENSCJAP00000020484	0.903	Uncharacterized protein
8	9483.ENSCJAP00000026970	0.894	Mucin 7, secreted
9	9483.ENSCJAP00000011714	0.885	Mucin 15, cell surface associated
10	9483.ENSCJAP00000036832	0.827	Mucin 21, cell surface associated
11	9483.ENSCJAP00000001810	0.791	Receptor protein-tyrosine kinase
12	9483.ENSCJAP00000022152	0.772	Erb-b2 receptor tyrosine kinase 3
13	9483.ENSCJAP00000000571	0.761	Uncharacterized protein
14	9483.ENSCJAP00000033870	0.697	Galectin
15	9483.ENSCJAP00000047274	0.697	Uncharacterized protein
16	9483.ENSCJAP00000027976	0.695	Hexosyltransferase
17	9483.ENSCJAP00000043237	0.690	Hexosyltransferase
18	9483.ENSCJAP00000031082	0.689	Fibulin 2
19	9483.ENSCJAP00000001088	0.684	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
20	9483.ENSCJAP00000049032	0.667	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005176	0.995	ErbB-2 class receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.854	multicellular organismal process
GO:0030277	0.838	maintenance of gastrointestinal epithelium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0005576	0.997	extracellular region
GO:0070013	0.997	intracellular organelle lumen
GO:0005886	0.995	plasma membrane
GO:0005796	0.991	Golgi lumen
GO:0005615	0.966	extracellular space
GO:0031982	0.954	vesicle
GO:0043230	0.933	extracellular organelle
GO:1903561	0.891	extracellular vesicle
GO:0070062	0.854	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]