StarFunc result for job id Q99217

User Input

>input (191 residues)
MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGW
LHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLP
PPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWP
STDKTKREEVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99217	0.998	0.998	1.138E-31	191	1.000	1.000	Q99217.pdb.gz	AMELX_HUMAN Amelogenin, X isoform OS=Homo sapiens OX=9606 GN=AMELX PE=1 SV=1
2	AFDB:P02817	0.179	0.166	3.631E-18	213	0.901	0.808	P02817.pdb.gz	AMELX_BOVIN Amelogenin, X isoform OS=Bos taurus OX=9913 GN=AMELX PE=1 SV=2
3	AFDB:Q8MIP2	0.106	0.066	5.715	377	0.178	0.090	Q8MIP2.pdb.gz	FOXL2_CAPHI Forkhead box protein L2 OS=Capra hircus OX=9925 GN=FOXL2 PE=1 SV=1
4	AFDB:E1B9V6	0.107	0.032	6.525	783	0.188	0.046	E1B9V6.pdb.gz	E1B9V6_BOVIN Rabenosyn, RAB effector OS=Bos taurus OX=9913 GN=RBSN PE=1 SV=1
5	PDB:7ungi	0.093	0.075	8.560	250	0.105	0.080	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99217	3.89e-128	360	191	1.000	1.000	AMELX_HUMAN Amelogenin, X isoform OS=Homo sapiens OX=9606 GN=AMELX PE=1 SV=1
2	P63277	7.84e-92	268	210	0.869	0.790	AMELX_MOUSE Amelogenin, X isoform OS=Mus musculus OX=10090 GN=Amelx PE=1 SV=1
3	P63278	7.84e-92	268	210	0.869	0.790	AMELX_RAT Amelogenin, X isoform OS=Rattus norvegicus OX=10116 GN=Amelx PE=2 SV=1
4	P45561	4.63e-73	220	189	0.859	0.868	AMEL_PIG Amelogenin OS=Sus scrofa OX=9823 GN=AMEL PE=1 SV=2
5	P02817	6.78e-72	218	213	0.885	0.793	AMELX_BOVIN Amelogenin, X isoform OS=Bos taurus OX=9913 GN=AMELX PE=1 SV=2
6	Q99218	5.01e-64	198	206	0.885	0.820	AMELY_HUMAN Amelogenin, Y isoform OS=Homo sapiens OX=9606 GN=AMELY PE=1 SV=2
7	C9E3B4	2.34e-05	46.6	1566	0.277	0.034	C9E3B4_STRMG Surface protein adhesin OS=Streptococcus mutans OX=1309 GN=spaP PE=1 SV=1
8	Q9VC64	0.008	38.9	1729	0.157	0.017	Q9VC64_DROME Anastral spindle 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ana1 PE=1 SV=1
9	Q62910	0.018	37.7	1574	0.157	0.019	SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus OX=10116 GN=Synj1 PE=1 SV=3
10	A0A8I6AHL9	0.021	37.7	3316	0.120	0.007	A0A8I6AHL9_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
11	A0A8I5ZTR6	0.029	37.4	3109	0.120	0.007	A0A8I5ZTR6_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
12	A0A8I6ADR1	0.041	36.6	2708	0.120	0.008	A0A8I6ADR1_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
13	M9PCJ6	0.043	36.6	18641	0.272	0.003	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	Q8WZ42	0.051	36.6	34350	0.099	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
15	M9PC48	0.056	36.2	18095	0.272	0.003	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	M9PEI1	0.12	35.4	21657	0.272	0.002	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PB30	0.13	35.4	22949	0.272	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
18	M9PC45	0.13	35.4	22300	0.272	0.002	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PEH5	0.13	35.4	20710	0.272	0.003	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PBZ0	0.16	35.0	22830	0.272	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02948 Amelogenin	2.3e-74	261.2	Amelogenin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000057175

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000027735	0.911	Uncharacterized protein
2	9598.ENSPTRP00000041774	0.880	Ameloblastin (enamel matrix protein)
3	9598.ENSPTRP00000027734	0.758	Uncharacterized protein
4	9598.ENSPTRP00000053314	0.752	Pan troglodytes lysosomal-associated membrane protein 1 (LAMP1), mRNA
5	9598.ENSPTRP00000007255	0.747	Matrix metallopeptidase 20
6	9598.ENSPTRP00000028386	0.691	Uncharacterized protein
7	9598.ENSPTRP00000027930	0.669	Dentin sialophosphoprotein
8	9598.ENSPTRP00000019515	0.638	Uncharacterized protein
9	9598.ENSPTRP00000052772	0.634	FAM20A, golgi associated secretory pathway pseudokinase
10	9598.ENSPTRP00000008613	0.631	Tetraspanin
11	9598.ENSPTRP00000015622	0.628	Uncharacterized protein
12	9598.ENSPTRP00000061395	0.601	Uncharacterized protein
13	9598.ENSPTRP00000037292	0.582	Uncharacterized protein
14	9598.ENSPTRP00000038749	0.582	Zinc finger Y-chromosomal protein
15	9598.ENSPTRP00000037102	0.565	Uncharacterized protein
16	9598.ENSPTRP00000027445	0.557	Quinoid dihydropteridine reductase
17	9598.ENSPTRP00000053013	0.555	Family with sequence similarity 83, member H
18	9598.ENSPTRP00000002201	0.545	Uncharacterized protein
19	9598.ENSPTRP00000027726	0.532	Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface
20	9598.ENSPTRP00000047491	0.523	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005201	0.999	extracellular matrix structural constituent
GO:0030345	0.920	structural constituent of tooth enamel

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0048513	0.995	animal organ development
GO:0009888	0.995	tissue development
GO:0009987	0.990	cellular process
GO:0050794	0.975	regulation of cellular process
GO:0042475	0.925	odontogenesis of dentin-containing tooth
GO:0048518	0.924	positive regulation of biological process
GO:0031214	0.909	biomineral tissue development
GO:0050896	0.852	response to stimulus
GO:0051716	0.738	cellular response to stimulus
GO:0070167	0.698	regulation of biomineral tissue development
GO:0048646	0.525	anatomical structure formation involved in morphogenesis
GO:0032501	0.524	multicellular organismal process
GO:0007154	0.477	cell communication
GO:0023052	0.448	signaling
GO:0019222	0.422	regulation of metabolic process
GO:0007275	0.306	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.997	cell periphery
GO:0070013	0.996	intracellular organelle lumen
GO:0012505	0.995	endomembrane system
GO:0005737	0.992	cytoplasm
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0031012	0.947	extracellular matrix
GO:0005783	0.925	endoplasmic reticulum
GO:0005788	0.915	endoplasmic reticulum lumen
GO:0062023	0.604	collagen-containing extracellular matrix
GO:0031981	0.426	nuclear lumen
GO:0005654	0.385	nucleoplasm
GO:0005576	0.339	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]