StarFunc result for job id Q99218

User Input

>input (206 residues)
MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYENSHSQAINVDRIALVLTPLKWYQSMI
RPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPG
QQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQPMQPQPPVQPMQPLLPQPPLPPMFPLR
PLPPILPDLHLEAWPATDKTKQEEVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99218	0.999	0.999	1.058E-30	206	1.000	1.000	Q99218.pdb.gz	AMELY_HUMAN Amelogenin, Y isoform OS=Homo sapiens OX=9606 GN=AMELY PE=1 SV=2
2	AFDB:P63277	0.211	0.222	7.826E-20	210	0.811	0.795	P63277.pdb.gz	AMELX_MOUSE Amelogenin, X isoform OS=Mus musculus OX=10090 GN=Amelx PE=1 SV=1
3	AFDB:Q9VYU7	0.115	0.041	1.118E-1	699	0.209	0.062	Q9VYU7.pdb.gz	Q9VYU7_DROME Dusky OS=Drosophila melanogaster OX=7227 GN=dy PE=2 SV=1
4	AFDB:P35526	0.120	0.071	1.937E-1	437	0.194	0.092	P35526.pdb.gz	CLIC5_BOVIN Chloride intracellular channel protein 5 OS=Bos taurus OX=9913 GN=CLIC5 PE=2 SV=1
5	AFDB:P9WLK3	0.167	0.123	2.732E-1	314	0.170	0.111	P9WLK3.pdb.gz	Y2083_MYCTU Uncharacterized protein Rv2083 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2083 PE=4 SV=1
6	AFDB:Q8W4P8	0.148	0.074	3.597E-1	611	0.155	0.052	Q8W4P8.pdb.gz	MEB1_ARATH Membrane protein of ER body 1 OS=Arabidopsis thaliana OX=3702 GN=MEB1 PE=1 SV=1
7	AFDB:Q96J87	0.145	0.075	3.853E-1	481	0.175	0.075	Q96J87.pdb.gz	CELF6_HUMAN CUGBP Elav-like family member 6 OS=Homo sapiens OX=9606 GN=CELF6 PE=1 SV=1
8	AFDB:Q80SU3	0.118	0.088	4.421E-1	361	0.126	0.072	Q80SU3.pdb.gz	ZAR1_MOUSE Zygote arrest protein 1 OS=Mus musculus OX=10090 GN=Zar1 PE=1 SV=1
9	AFDB:Q8BMF8	0.166	0.073	4.421E-1	549	0.165	0.062	Q8BMF8.pdb.gz	GLDN_MOUSE Gliomedin OS=Mus musculus OX=10090 GN=Gldn PE=1 SV=1
10	AFDB:Q62897	0.107	0.045	4.736E-1	655	0.194	0.061	Q62897.pdb.gz	KCND3_RAT Potassium voltage-gated channel subfamily D member 3 OS=Rattus norvegicus OX=10116 GN=Kcnd3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99218	1.74e-143	400	206	1.000	1.000	AMELY_HUMAN Amelogenin, Y isoform OS=Homo sapiens OX=9606 GN=AMELY PE=1 SV=2
2	P63277	4.38e-96	280	210	0.811	0.795	AMELX_MOUSE Amelogenin, X isoform OS=Mus musculus OX=10090 GN=Amelx PE=1 SV=1
3	P63278	4.38e-96	280	210	0.811	0.795	AMELX_RAT Amelogenin, X isoform OS=Rattus norvegicus OX=10116 GN=Amelx PE=2 SV=1
4	P45561	3.62e-64	198	189	0.777	0.847	AMEL_PIG Amelogenin OS=Sus scrofa OX=9823 GN=AMEL PE=1 SV=2
5	P02817	1.70e-62	195	213	0.563	0.545	AMELX_BOVIN Amelogenin, X isoform OS=Bos taurus OX=9913 GN=AMELX PE=1 SV=2
6	Q99217	1.62e-59	186	191	0.820	0.885	AMELX_HUMAN Amelogenin, X isoform OS=Homo sapiens OX=9606 GN=AMELX PE=1 SV=1
7	C9E3B4	3.70e-04	43.1	1566	0.155	0.020	C9E3B4_STRMG Surface protein adhesin OS=Streptococcus mutans OX=1309 GN=spaP PE=1 SV=1
8	A0A1D8PTW7	0.001	41.2	690	0.097	0.029	A0A1D8PTW7_CANAL Serine/threonine/tyrosine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MPS1 PE=4 SV=1
9	P32521	0.12	35.4	1480	0.121	0.017	PAN1_YEAST Actin cytoskeleton-regulatory complex protein PAN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAN1 PE=1 SV=2
10	P46087	0.14	35.4	812	0.117	0.030	NOP2_HUMAN Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2
11	A2ASS6	0.70	33.1	35213	0.126	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
12	M9PC48	0.71	33.1	18095	0.121	0.001	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PCJ6	0.72	33.1	18641	0.121	0.001	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	Q800E4	0.72	33.1	2468	0.194	0.016	Q800E4_DANRE Neurogenic locus notch homolog protein 3 precursor OS=Danio rerio OX=7955 GN=fa14b08 PE=1 SV=1
15	M9PEI1	1.2	32.3	21657	0.121	0.001	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	M9PB30	1.3	32.3	22949	0.121	0.001	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
17	M9PC41	1.3	32.3	22743	0.121	0.001	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PC45	1.3	32.3	22300	0.121	0.001	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PEH5	1.3	32.3	20710	0.121	0.001	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PBZ0	1.5	32.3	22830	0.121	0.001	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02948 Amelogenin	3.7e-65	231.2	Amelogenin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000038754

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000037088	0.786	Transducin beta like 1, Y-linked
2	9598.ENSPTRP00000038766	0.709	USP9Y
3	9598.ENSPTRP00000037292	0.686	Uncharacterized protein
4	9598.ENSPTRP00000038749	0.686	Zinc finger Y-chromosomal protein
5	9598.ENSPTRP00000027735	0.684	Uncharacterized protein
6	9598.ENSPTRP00000048424	0.680	Uncharacterized protein
7	9598.ENSPTRP00000041774	0.678	Ameloblastin (enamel matrix protein)
8	9598.ENSPTRP00000007255	0.667	Matrix metallopeptidase 20
9	9598.ENSPTRP00000053314	0.667	Pan troglodytes lysosomal-associated membrane protein 1 (LAMP1), mRNA
10	9598.ENSPTRP00000038793	0.654	Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. May play a role in spermatogenesis. Involved in transcriptional repression of diverse metastasis-associated genes
11	9598.ENSPTRP00000061235	0.646	Pan troglodytes protein kinase, X-linked (PRKX), mRNA
12	9598.ENSPTRP00000052772	0.634	FAM20A, golgi associated secretory pathway pseudokinase
13	9598.ENSPTRP00000058594	0.626	Male-specific histone demethylase that catalyzes trimethylated 'Lys-27' (H3K27me3) demethylation in histone H3. Has relatively low lysine demethylase activity.
14	9598.ENSPTRP00000037079	0.603	Uncharacterized protein
15	9598.ENSPTRP00000061395	0.601	Uncharacterized protein
16	9598.ENSPTRP00000027734	0.580	Uncharacterized protein
17	9598.ENSPTRP00000038745	0.569	Sex-determining region Y protein
18	9598.ENSPTRP00000038748	0.567	Pan troglodytes ribosomal protein S4, Y-linked 1 (RPS4Y1), mRNA
19	9598.ENSPTRP00000038771	0.567	ATP-dependent RNA helicase DDX3Y
20	9598.ENSPTRP00000019515	0.564	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	1.000	extracellular matrix structural constituent
GO:0030345	0.959	structural constituent of tooth enamel
GO:0043167	0.486	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.994	anatomical structure development
GO:0009987	0.984	cellular process
GO:0050789	0.976	regulation of biological process
GO:0031214	0.941	biomineral tissue development
GO:0042475	0.936	odontogenesis of dentin-containing tooth
GO:0050896	0.886	response to stimulus
GO:0032501	0.866	multicellular organismal process
GO:0050794	0.845	regulation of cellular process
GO:0048646	0.727	anatomical structure formation involved in morphogenesis
GO:0007275	0.651	multicellular organism development
GO:0048731	0.534	system development
GO:0048518	0.517	positive regulation of biological process
GO:0019222	0.387	regulation of metabolic process
GO:0030154	0.356	cell differentiation
GO:0007165	0.349	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.997	cell periphery
GO:0031012	0.994	extracellular matrix
GO:0043231	0.855	intracellular membrane-bounded organelle
GO:0005737	0.764	cytoplasm
GO:0012505	0.544	endomembrane system
GO:0062023	0.532	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]