StarFunc result for job id Q99250

User Input

>input (2005 residues)
MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGK
SLPFIYGDIPPEMVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRK
LAIKILVHSLFNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFC
LEDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGA
LIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSL
DGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNP
NYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLI
LAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESRDFSGAGGI
GVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKNDRVRKSESEDSIRRKGFRFS
LEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFRGRAKDIGSENDFADDEHST
FEDNDSRRDSLFVPHRHGERRHSNVSQASRASRVLPILPMNGKMHSAVDCNGVVSLVGGP
STLTSAGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSIASILTNTMEELEE
SRQKCPPCWYKFANMCLIWDCCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEH
YPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGL
ANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGM
QLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCL
TVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRK
IREFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGS
SVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSS
SEGSTVDIGAPAEGEQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKT
CYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLK
WVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRF
EGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVV
NNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQ
PKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNA
MKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMT
NILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFV
SPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMS
NFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPDKDHPGS
SVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYE
VWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFA
FTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYL
LKQKVKKVSSIYKKDKGKECDGTPIKEDTLIDKLNENSTPEKTDMTPSTTSPPSYDSVTK
PEKEKFEKDKSEKEDKGKDIRESKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6agfA	0.560	0.981	0.000	1138	0.487	0.858	6agfA.pdb.gz	Structure of the human voltage-gated sodium channel Nav1.4 in complex with beta 1.
2	PDB:6j8eA	0.560	0.980	0.000	1139	0.568	0.999	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.
3	PDB:6j8gA	0.552	0.965	0.000	1140	0.483	0.850	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
4	PDB:7w9lA	0.638	0.895	0.000	1420	0.600	0.847	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
5	PDB:7xveA	0.586	0.902	0.000	1276	0.529	0.831	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
6	AFDB:A0A0G2KYI1	0.785	0.805	0.000	1954	0.655	0.672	A0A0G2KYI1.pdb.gz
7	AFDB:A2APX8	0.867	0.865	0.000	2009	0.877	0.875	A2APX8.pdb.gz	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
8	AFDB:B1AWN6	0.881	0.880	0.000	2006	0.981	0.980	B1AWN6.pdb.gz	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
9	AFDB:F1LQQ7	0.705	0.824	0.000	1704	0.417	0.491	F1LQQ7.pdb.gz	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
10	AFDB:F1R3Q5	0.791	0.820	0.000	1932	0.639	0.663	F1R3Q5.pdb.gz
11	AFDB:P08104	0.856	0.879	0.000	1951	0.853	0.876	P08104.pdb.gz	SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn3a PE=1 SV=1
12	AFDB:P15389	0.769	0.764	0.000	2019	0.631	0.627	P15389.pdb.gz	SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn5a PE=1 SV=1
13	AFDB:Q01118	0.716	0.847	0.000	1682	0.452	0.539	Q01118.pdb.gz	SCN7A_HUMAN Sodium channel protein type 7 subunit alpha OS=Homo sapiens OX=9606 GN=SCN7A PE=1 SV=2
14	AFDB:Q15858	0.855	0.862	0.000	1988	0.779	0.785	Q15858.pdb.gz	SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens OX=9606 GN=SCN9A PE=1 SV=3
15	AFDB:Q9UQD0	0.840	0.851	0.000	1980	0.759	0.768	Q9UQD0.pdb.gz	SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
16	PDB:6lqaB	0.557	0.964	1.800E-101	1151	0.454	0.791	6lqaB.pdb.gz	Structural Basis for Pore Blockade of the Human Cardiac Sodium Channel Na v 1.5 by the Antiarrhythmic Drug Quinidine*.
17	PDB:7we4A	0.537	0.949	2.230E-100	1122	0.403	0.720	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
18	PDB:6uz3A	0.541	0.955	2.077E-96	1126	0.445	0.793	6uz3A.pdb.gz	Structure of the Cardiac Sodium Channel.
19	PDB:7tj9A	0.535	0.954	3.074E-82	1111	0.320	0.578	7tj9A.pdb.gz	Structure-guided unlocking of Na X reveals a non-selective tetrodotoxin-sensitive cation channel.
20	PDB:7mixA	0.530	0.787	7.534E-51	1326	0.189	0.286	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MT39	2447	1962	0.644	0.658	A0A0A0MT39_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
2	A0A0R4IUM7	2565	1955	0.670	0.687	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
3	A0A1B0GVX7	2776	1618	0.705	0.873	A0A1B0GVX7_HUMAN Sodium voltage-gated channel alpha subunit 1 OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
4	A0A1W2PPJ3	3449	1998	0.871	0.874	A0A1W2PPJ3_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
5	A0A286YEQ8	1047	1915	0.257	0.269	A0A286YEQ8_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
6	A0A286YF26	3458	1997	0.873	0.876	A0A286YF26_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
7	A0A590UK43	2850	1939	0.744	0.769	A0A590UK43_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
8	A0A8I6GH51	1227	1672	0.317	0.380	A0A8I6GH51_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=3 SV=1
9	A2APX8	3479	2009	0.867	0.866	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
10	A2ASI5	3308	1947	0.852	0.878	SCN3A_MOUSE Sodium channel protein type 3 subunit alpha OS=Mus musculus OX=10090 GN=Scn3a PE=1 SV=1
11	B1AWN6	4060	2006	0.981	0.980	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
12	B1AYL1	1273	1681	0.329	0.393	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
13	E9PG18	1162	1998	0.313	0.314	E9PG18_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
14	E9PHB6	2348	1983	0.629	0.636	E9PHB6_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
15	F1LQQ7	1246	1680	0.319	0.380	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
16	F1QXF5	3166	1996	0.795	0.799	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
17	H9KVD2	2405	2016	0.640	0.636	H9KVD2_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
18	K4DIA1	2442	1962	0.642	0.656	K4DIA1_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
19	O08562	2996	1984	0.779	0.787	SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn9a PE=1 SV=1
20	O88420	2940	1978	0.750	0.760	SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn8a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00430 ATP-synt_B	4.2	18.9	ATP synthase B/B' CF(0)
2	PF16905 GPHH	0.74	21.1	Voltage-dependent L-type calcium channel, IQ-associated
3	PF00520 Ion_trans	8e-254	849.0	Ion transport protein
4	PF00612 IQ	14	16.8	IQ calmodulin-binding motif
5	PF06512 Na_trans_assoc	6.7e-60	214.3	Sodium ion transport-associated
6	PF11933 Na_trans_cytopl	1.4e-56	202.7	Cytoplasmic domain of voltage-gated Na+ ion channel
7	PF08016 PKD_channel	7.9e-06	37.0	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364586

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280772	0.989	Ankyrin-3
2	9606.ENSP00000278947	0.984	Sodium channel subunit beta-2
3	9606.ENSP00000291295	0.973	Calmodulin 3 (phosphorylase kinase, delta)
4	9606.ENSP00000283254	0.968	Sodium channel protein type 3 subunit alpha
5	9606.ENSP00000349467	0.946	Calmodulin-1
6	9606.ENSP00000396915	0.946	Sodium channel subunit beta-1
7	9606.ENSP00000396320	0.943	Sodium channel protein type 4 subunit alpha
8	9606.ENSP00000322460	0.923	Sodium channel subunit beta-4
9	9606.ENSP00000352035	0.923	Potassium voltage-gated channel subfamily KQT member 2
10	9606.ENSP00000376523	0.912	Sodium channel subunit beta-3
11	9606.ENSP00000272298	0.905	Calmodulin 2 (phosphorylase kinase, delta)
12	9606.ENSP00000263373	0.879	Spectrin beta chain, non-erythrocytic 4
13	9606.ENSP00000373648	0.877	Potassium voltage-gated channel subfamily KQT member 3
14	9606.ENSP00000349588	0.876	Ankyrin-2
15	9606.ENSP00000344786	0.873	Neurofascin
16	9606.ENSP00000261917	0.857	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
17	9606.ENSP00000371985	0.815	Potassium voltage-gated channel subfamily A member 1
18	9606.ENSP00000368314	0.814	Neuronal cell adhesion molecule
19	9606.ENSP00000433109	0.813	Potassium voltage-gated channel subfamily A member 2
20	9606.ENSP00000329926	0.811	Calcium homeostasis modulator protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005248	1.000	voltage-gated sodium channel activity
GO:0005515	0.990	protein binding
GO:0022836	0.414	gated channel activity
GO:0022839	0.390	monoatomic ion gated channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0065007	0.985	biological regulation
GO:0006814	0.969	sodium ion transport
GO:0032501	0.965	multicellular organismal process
GO:0050896	0.941	response to stimulus
GO:0065008	0.921	regulation of biological quality
GO:0042391	0.874	regulation of membrane potential
GO:0050789	0.825	regulation of biological process
GO:0003008	0.819	system process
GO:0001508	0.769	action potential
GO:0019228	0.738	neuronal action potential
GO:0007610	0.612	behavior
GO:0055085	0.609	transmembrane transport
GO:0050794	0.541	regulation of cellular process
GO:0098662	0.496	inorganic cation transmembrane transport
GO:0034220	0.496	monoatomic ion transmembrane transport
GO:0098655	0.463	monoatomic cation transmembrane transport
GO:0042221	0.401	response to chemical
GO:0006950	0.399	response to stress
GO:0023052	0.368	signaling
GO:0032502	0.326	developmental process
GO:0051716	0.305	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.979	protein-containing complex
GO:0005622	0.942	intracellular anatomical structure
GO:0098796	0.828	membrane protein complex
GO:0043227	0.824	membrane-bounded organelle
GO:0034702	0.817	ion channel complex
GO:0043229	0.806	intracellular organelle
GO:0034703	0.794	cation channel complex
GO:0043231	0.768	intracellular membrane-bounded organelle
GO:0098797	0.760	plasma membrane protein complex
GO:0031974	0.589	membrane-enclosed lumen
GO:0043233	0.565	organelle lumen
GO:0005634	0.563	nucleus
GO:0070013	0.549	intracellular organelle lumen
GO:0034706	0.530	sodium channel complex
GO:0005737	0.497	cytoplasm
GO:0001518	0.460	voltage-gated sodium channel complex
GO:0042995	0.309	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]