StarFunc result for job id Q99445

User Input

>input (158 residues)
MLLFALLLAMELPLVAASATMRAQWTYSLRCHDCAVINDFNCPNIRVCPYHIRRCMTISI
RINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLER
DMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99445	1.000	1.000	7.771E-30	158	1.000	1.000	Q99445.pdb.gz	GML_HUMAN Glycosyl-phosphatidylinositol-anchored molecule-like protein OS=Homo sapiens OX=9606 GN=GML PE=2 SV=1
2	AFDB:Q17RY6	0.460	0.442	3.762E-9	165	0.304	0.291	Q17RY6.pdb.gz	LY6K_HUMAN Lymphocyte antigen 6K OS=Homo sapiens OX=9606 GN=LY6K PE=1 SV=2
3	AFDB:Q9CWP4	0.497	0.509	5.398E-9	154	0.222	0.227	Q9CWP4.pdb.gz	LY6K_MOUSE Lymphocyte antigen 6K OS=Mus musculus OX=10090 GN=Ly6k PE=1 SV=1
4	AFDB:P0DP58	0.408	0.537	7.526E-7	116	0.203	0.276	P0DP58.pdb.gz	LYNX1_HUMAN Ly-6/neurotoxin-like protein 1 OS=Homo sapiens OX=9606 GN=LYNX1 PE=1 SV=1
5	AFDB:P0DP60	0.407	0.535	2.095E-6	116	0.209	0.284	P0DP60.pdb.gz	LYNX1_MOUSE Ly-6/neurotoxin-like protein 1 OS=Mus musculus OX=10090 GN=Lynx1 PE=1 SV=1
6	AFDB:P35459	0.416	0.503	2.665E-6	127	0.234	0.291	P35459.pdb.gz	LY6D_MOUSE Lymphocyte antigen 6D OS=Mus musculus OX=10090 GN=Ly6d PE=1 SV=1
7	AFDB:Q8BLC3	0.421	0.462	2.665E-6	141	0.171	0.191	Q8BLC3.pdb.gz	LYPD1_MOUSE Ly6/PLAUR domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lypd1 PE=1 SV=1
8	AFDB:Q14210	0.427	0.512	5.169E-6	128	0.247	0.305	Q14210.pdb.gz	LY6D_HUMAN Lymphocyte antigen 6D OS=Homo sapiens OX=9606 GN=LY6D PE=1 SV=1
9	AFDB:A0A1D5P7D9	0.356	0.434	6.985E-6	126	0.190	0.238	A0A1D5P7D9.pdb.gz
10	AFDB:P0CW02	0.395	0.467	7.879E-6	131	0.215	0.260	P0CW02.pdb.gz	LY6C1_MOUSE Lymphocyte antigen 6C1 OS=Mus musculus OX=10090 GN=Ly6c1 PE=2 SV=1
11	PDB:2n99A	0.337	0.649	1.034E-3	76	0.133	0.276	2n99A.pdb.gz
12	PDB:6wjcC	0.328	0.701	4.947E-3	69	0.114	0.261	6wjcC.pdb.gz	Structure and selectivity engineering of the M1muscarinic receptor toxin complex.
13	PDB:3vtsA	0.288	0.688	7.541E-3	61	0.095	0.246	3vtsA.pdb.gz
14	PDB:4zqyA	0.290	0.646	1.019E-2	65	0.114	0.277	4zqyA.pdb.gz
15	PDB:6zzeA	0.326	0.584	2.367E-2	82	0.114	0.220	6zzeA.pdb.gz
16	PDB:6rc7A	0.273	0.638	8.384E-2	60	0.095	0.250	6rc7A.pdb.gz
17	PDB:3bt1U	0.299	0.186	1.727E-1	273	0.089	0.051	3bt1U.pdb.gz
18	PDB:3laqV	0.364	0.231	2.197E-1	260	0.101	0.062	3laqV.pdb.gz
19	PDB:3fxiC	0.128	0.142	2.165	140	0.063	0.071	3fxiC.pdb.gz
20	PDB:6v8oO	0.145	0.078	2.300	384	0.076	0.031	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99445	5.14e-116	326	158	1.000	1.000	GML_HUMAN Glycosyl-phosphatidylinositol-anchored molecule-like protein OS=Homo sapiens OX=9606 GN=GML PE=2 SV=1
2	Q9CWP4	2.18e-06	47.0	154	0.241	0.247	LY6K_MOUSE Lymphocyte antigen 6K OS=Mus musculus OX=10090 GN=Ly6k PE=1 SV=1
3	Q17RY6	2.91e-05	44.3	165	0.177	0.170	LY6K_HUMAN Lymphocyte antigen 6K OS=Homo sapiens OX=9606 GN=LY6K PE=1 SV=2
4	P35459	1.96e-04	41.2	127	0.165	0.205	LY6D_MOUSE Lymphocyte antigen 6D OS=Mus musculus OX=10090 GN=Ly6d PE=1 SV=1
5	Q14210	0.024	35.4	128	0.171	0.211	LY6D_HUMAN Lymphocyte antigen 6D OS=Homo sapiens OX=9606 GN=LY6D PE=1 SV=1
6	P57096	0.044	34.7	123	0.215	0.276	PSCA_MOUSE Prostate stem cell antigen OS=Mus musculus OX=10090 GN=Psca PE=1 SV=2
7	Q9NGX8	0.65	32.3	903	0.152	0.027	Q9NGX8_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=wit PE=2 SV=2
8	Q95V83	0.70	32.3	903	0.152	0.027	Q95V83_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=wit PE=3 SV=1
9	M9PE88	0.73	32.3	913	0.152	0.026	M9PE88_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=wit PE=3 SV=1
10	Q9VZI9	0.73	32.3	903	0.152	0.027	Q9VZI9_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=wit PE=2 SV=1
11	P0DP58	0.88	30.8	116	0.215	0.293	LYNX1_HUMAN Ly-6/neurotoxin-like protein 1 OS=Homo sapiens OX=9606 GN=LYNX1 PE=1 SV=1
12	P0DP60	0.98	30.8	116	0.158	0.216	LYNX1_MOUSE Ly-6/neurotoxin-like protein 1 OS=Mus musculus OX=10090 GN=Lynx1 PE=1 SV=1
13	E7F8K3	4.0	29.3	132	0.196	0.235	E7F8K3_DANRE CD59 glycoprotein isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-286c4.6 PE=1 SV=1
14	Q288P3	5.8	29.6	1003	0.146	0.023	Q288P3_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=bmpr2a PE=2 SV=1
15	Q12314	5.9	29.3	213	0.082	0.061	SFM1_YEAST Protein arginine N-methyltransferase SFM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SFM1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00021 UPAR_LY6	1.2e+02	14.8	u-PAR/Ly-6 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220940

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428572	0.739	Lymphocyte antigen 6E
2	9606.ENSP00000473842	0.690	Endogenous Bornavirus-like nucleoprotein 1
3	9606.ENSP00000287239	0.676	Histone acetyltransferase KAT6B
4	9606.ENSP00000476510	0.659	LY6/PLAUR domain containing 4
5	9606.ENSP00000455811	0.609	Lymphocyte antigen 6L
6	9606.ENSP00000432104	0.598	Endogenous Bornavirus-like nucleoprotein 2
7	9606.ENSP00000399485	0.572	Lymphocyte antigen 6H
8	9606.ENSP00000395505	0.563	Prostate and testis expressed 3
9	9606.ENSP00000479240	0.558	Phospholipase A2 inhibitor and LY6/PLAUR domain containing
10	9606.ENSP00000352163	0.553	LY6/PLAUR domain containing 2
11	9606.ENSP00000359990	0.539	Leucine-rich repeat-containing protein 40
12	9606.ENSP00000246515	0.522	Secreted Ly-6/uPAR-related protein 1
13	9606.ENSP00000262932	0.521	Protein canopy homolog 4
14	9606.ENSP00000411439	0.520	Prostate and testis expressed protein 4
15	9606.ENSP00000367185	0.517	LY6/PLAUR domain containing 5
16	9606.ENSP00000475702	0.514	Lymphocyte antigen 6 family member G6E
17	9606.ENSP00000372910	0.513	Lymphocyte antigen 6 family member G6E
18	9606.ENSP00000351325	0.508	Prostate and testis expressed 2
19	9606.ENSP00000307164	0.505	Prostate and testis expressed 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0098772	0.575	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0000278	0.996	mitotic cell cycle
GO:0044773	0.990	mitotic DNA damage checkpoint signaling
GO:0072331	0.989	signal transduction by p53 class mediator
GO:2000134	0.989	negative regulation of G1/S transition of mitotic cell cycle
GO:0012501	0.986	programmed cell death
GO:0044819	0.981	mitotic G1/S transition checkpoint signaling
GO:0006915	0.977	apoptotic process
GO:0042127	0.975	regulation of cell population proliferation
GO:0030330	0.964	DNA damage response, signal transduction by p53 class mediator
GO:0008285	0.556	negative regulation of cell population proliferation
GO:0031571	0.333	mitotic G1 DNA damage checkpoint signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0019898	0.964	extrinsic component of membrane
GO:0043227	0.610	membrane-bounded organelle
GO:0005622	0.584	intracellular anatomical structure
GO:0043229	0.564	intracellular organelle
GO:0005576	0.479	extracellular region
GO:0043231	0.444	intracellular membrane-bounded organelle
GO:0005737	0.427	cytoplasm
GO:0012505	0.357	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]