StarFunc result for job id Q99453

User Input

>input (314 residues)
MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSL
TPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTTFTSAQLKELERVFAET
HYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAAAAKNGSSGKKSDSSR
DDESKEAKSTDPDSTGGPGPNPNPTPSCGANGGGGGGPSPAGAPGAAGPGGPGGEPGKGG
AAAAAAAAAAAAAAAAAAAAGGLAAAGGPGQGWAPGPGPITSIPDSLGGPFASVLSSLQR
PNGAKAALVKSSMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JYE6	0.362	0.370	9.512E-39	307	0.968	0.990	A0A0G2JYE6.pdb.gz	A0A0G2JYE6_RAT Paired-like homeobox 2b OS=Rattus norvegicus OX=10116 GN=Phox2b PE=4 SV=2
2	AFDB:Q3T498	0.309	0.334	5.730E-29	285	0.774	0.853	Q3T498.pdb.gz
3	AFDB:O14813	0.341	0.371	1.362E-19	284	0.538	0.595	O14813.pdb.gz	PHX2A_HUMAN Paired mesoderm homeobox protein 2A OS=Homo sapiens OX=9606 GN=PHOX2A PE=1 SV=2
4	AFDB:P22810	0.257	0.155	1.001E-9	542	0.312	0.181	P22810.pdb.gz	HMOC_DROME Homeotic protein ocelliless OS=Drosophila melanogaster OX=7227 GN=oc PE=2 SV=2
5	AFDB:Q6DGH9	0.214	0.213	1.821E-9	315	0.258	0.257	Q6DGH9.pdb.gz	OTBP_DANRE Homeobox protein orthopedia B OS=Danio rerio OX=7955 GN=otpb PE=1 SV=1
6	AFDB:Q9V490	0.239	0.146	3.311E-9	543	0.232	0.134	Q9V490.pdb.gz	Q9V490_DROME GH14454p OS=Drosophila melanogaster OX=7227 GN=toy PE=2 SV=4
7	AFDB:O42115	0.217	0.153	4.932E-9	453	0.287	0.199	O42115.pdb.gz	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
8	AFDB:B0S5T0	0.226	0.247	5.270E-9	285	0.261	0.288	B0S5T0.pdb.gz	B0S5T0_DANRE Short stature homeobox OS=Danio rerio OX=7955 GN=si:ch211-134k13.1 PE=4 SV=1
9	AFDB:F1Q9S0	0.242	0.166	7.347E-9	469	0.261	0.175	F1Q9S0.pdb.gz	F1Q9S0_DANRE Paired box 3b OS=Danio rerio OX=7955 GN=pax3b PE=3 SV=2
10	AFDB:C0M005	0.224	0.141	9.583E-9	510	0.248	0.153	C0M005.pdb.gz	C0M005_DANRE Paired box 7b OS=Danio rerio OX=7955 GN=pax7b PE=2 SV=1
11	PDB:4egcA	0.158	0.092	8.468E-3	539	0.054	0.032	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.157	0.601	1.180E-2	73	0.061	0.260	2hi3A.pdb.gz
13	PDB:7fbyA	0.121	0.227	9.465E-1	153	0.032	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:6xywBD	0.141	0.205	1.610	210	0.035	0.052	6xywBD.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
15	PDB:4ldzA	0.157	0.244	1.839	196	0.032	0.051	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
16	PDB:5nr5A	0.129	0.323	1.839	113	0.032	0.088	5nr5A.pdb.gz
17	PDB:1l3lB	0.118	0.156	2.100	233	0.029	0.039	1l3lB.pdb.gz	Structure of a bacterial quorum-sensing transcription factor complexed with pheromone and DNA.
18	PDB:5mrca	0.108	0.182	2.564	177	0.045	0.079	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:2cjjA	0.157	0.674	2.740	63	0.025	0.127	2cjjA.pdb.gz
20	PDB:5aj0BZ	0.119	0.320	2.928	86	0.013	0.047	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JYE6	0.0	625	314	1.000	1.000	A0A0G2JYE6_RAT Paired-like homeobox 2b OS=Rattus norvegicus OX=10116 GN=Phox2b PE=4 SV=2
2	O35690	0.0	625	314	1.000	1.000	PHX2B_MOUSE Paired mesoderm homeobox protein 2B OS=Mus musculus OX=10090 GN=Phox2b PE=1 SV=1
3	Q99453	0.0	625	314	1.000	1.000	PHX2B_HUMAN Paired mesoderm homeobox protein 2B OS=Homo sapiens OX=9606 GN=PHOX2B PE=1 SV=2
4	Q5I7G4	6.90e-168	469	284	0.796	0.880	Q5I7G4_DANRE Paired mesoderm homeobox protein 2B OS=Danio rerio OX=7955 GN=phox2b PE=2 SV=1
5	F1RCT9	2.48e-95	285	280	0.525	0.589	F1RCT9_DANRE Paired mesoderm homeobox protein 2A isoform X1 OS=Danio rerio OX=7955 GN=arix PE=4 SV=1
6	Q6NYV4	1.85e-92	278	277	0.516	0.585	Q6NYV4_DANRE Paired mesoderm homeobox protein 2A OS=Danio rerio OX=7955 GN=arix PE=2 SV=1
7	Q62066	6.78e-82	251	280	0.529	0.593	PHX2A_MOUSE Paired mesoderm homeobox protein 2A OS=Mus musculus OX=10090 GN=Phox2a PE=2 SV=1
8	Q62782	1.97e-79	244	281	0.424	0.473	PHX2A_RAT Paired mesoderm homeobox protein 2A OS=Rattus norvegicus OX=10116 GN=Phox2a PE=2 SV=1
9	O14813	4.15e-79	244	284	0.424	0.468	PHX2A_HUMAN Paired mesoderm homeobox protein 2A OS=Homo sapiens OX=9606 GN=PHOX2A PE=1 SV=2
10	G5EC89	1.70e-35	130	237	0.178	0.236	CEH17_CAEEL Homeobox protein ceh-17 OS=Caenorhabditis elegans OX=6239 GN=ceh-17 PE=1 SV=1
11	Q21836	6.91e-31	121	362	0.162	0.141	ARXH_CAEEL Homeobox ARX homolog alr-1 OS=Caenorhabditis elegans OX=6239 GN=alr-1 PE=1 SV=1
12	O42115	2.00e-30	121	453	0.166	0.115	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
13	A6NNA5	2.24e-30	117	263	0.178	0.213	DRGX_HUMAN Dorsal root ganglia homeobox protein OS=Homo sapiens OX=9606 GN=DRGX PE=3 SV=1
14	Q8BYH0	2.38e-30	117	263	0.178	0.213	DRGX_MOUSE Dorsal root ganglia homeobox protein OS=Mus musculus OX=10090 GN=Drgx PE=1 SV=2
15	A6YP92	2.90e-30	122	566	0.166	0.092	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
16	Q96QS3	3.16e-30	122	562	0.166	0.093	ARX_HUMAN Homeobox protein ARX OS=Homo sapiens OX=9606 GN=ARX PE=1 SV=1
17	Q06453	3.37e-30	120	408	0.159	0.123	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2
18	Q8T0V5	4.15e-30	119	357	0.156	0.137	Q8T0V5_DROME GH01528p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
19	O35085	4.28e-30	121	564	0.166	0.092	ARX_MOUSE Homeobox protein ARX OS=Mus musculus OX=10090 GN=Arx PE=1 SV=3
20	Q9XZU0	4.42e-30	119	357	0.156	0.137	Q9XZU0_DROME FI01102p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	3e+02	12.8	Homeobox KN domain
2	PF00046 Homeodomain	2.3e-19	80.3	Homeodomain
3	PF12776 Myb_DNA-bind_3	4.7e+02	13.2	Myb/SANT-like DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020931

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016172	0.697	Dopamine beta-hydroxylase (dopamine beta-monooxygenase)
2	61853.ENSNLEP00000013061	0.617	ISL LIM homeobox 1
3	61853.ENSNLEP00000018862	0.607	RNA binding motif protein 20
4	61853.ENSNLEP00000008116	0.584	Heart and neural crest derivatives expressed 2
5	61853.ENSNLEP00000022685	0.583	annotation not available
6	61853.ENSNLEP00000016308	0.567	Tyrosine hydroxylase
7	61853.ENSNLEP00000010180	0.563	Gastrin-releasing peptide
8	61853.ENSNLEP00000009502	0.559	Zic family member 2
9	61853.ENSNLEP00000014530	0.559	GATA binding protein 3
10	61853.ENSNLEP00000020924	0.541	LIM and calponin homology domains 1
11	61853.ENSNLEP00000017404	0.529	GATA binding protein 2
12	61853.ENSNLEP00000017634	0.523	MYCN proto-oncogene, bHLH transcription factor
13	61853.ENSNLEP00000012366	0.521	Myosin, heavy chain 13, skeletal muscle
14	61853.ENSNLEP00000021666	0.521	Solute carrier family 17 (vesicular glutamate transporter), member 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.999	protein binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.993	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.322	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007275	0.995	multicellular organism development
GO:0048731	0.991	system development
GO:0050789	0.987	regulation of biological process
GO:0009987	0.986	cellular process
GO:0007399	0.984	nervous system development
GO:0050794	0.983	regulation of cellular process
GO:0019222	0.979	regulation of metabolic process
GO:0048483	0.973	autonomic nervous system development
GO:0060255	0.971	regulation of macromolecule metabolic process
GO:0080090	0.932	regulation of primary metabolic process
GO:0010468	0.929	regulation of gene expression
GO:0031323	0.926	regulation of cellular metabolic process
GO:0030154	0.918	cell differentiation
GO:0051171	0.910	regulation of nitrogen compound metabolic process
GO:0048522	0.909	positive regulation of cellular process
GO:0019219	0.874	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.865	regulation of biosynthetic process
GO:0006355	0.849	regulation of DNA-templated transcription
GO:0048484	0.807	enteric nervous system development
GO:0010604	0.782	positive regulation of macromolecule metabolic process
GO:0051173	0.768	positive regulation of nitrogen compound metabolic process
GO:0031325	0.722	positive regulation of cellular metabolic process
GO:0030182	0.709	neuron differentiation
GO:0006357	0.689	regulation of transcription by RNA polymerase II
GO:0048513	0.638	animal organ development
GO:0050896	0.565	response to stimulus
GO:0045935	0.481	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.475	positive regulation of cellular biosynthetic process
GO:0009653	0.409	anatomical structure morphogenesis
GO:0010557	0.381	positive regulation of macromolecule biosynthetic process
GO:0048519	0.362	negative regulation of biological process
GO:0051254	0.357	positive regulation of RNA metabolic process
GO:1902680	0.353	positive regulation of RNA biosynthetic process
GO:1903508	0.335	positive regulation of nucleic acid-templated transcription
GO:0045893	0.333	positive regulation of DNA-templated transcription
GO:0048523	0.329	negative regulation of cellular process
GO:0048468	0.301	cell development
GO:0045944	0.301	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031974	0.874	membrane-enclosed lumen
GO:0070013	0.847	intracellular organelle lumen
GO:0031981	0.804	nuclear lumen
GO:0005654	0.704	nucleoplasm
GO:0005737	0.508	cytoplasm
GO:0043228	0.456	non-membrane-bounded organelle
GO:0043232	0.452	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]