StarFunc result for job id Q99456

User Input

>input (494 residues)
MDLSNNTMSLSVRTPGLSRRLSSQSVIGRPRGMSASSVGSGYGGSAFGFGASCGGGFSAA
SMFGSSSGFGGGSGSSMAGGLGAGYGRALGGGSFGGLGMGFGGSPGGGSLGILSGNDGGL
LSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYY
PLIEDLRNKIISASIGNAQLLLQIDNARLAAEDFRMKYENELALRQGVEADINGLRRVLD
ELTLTRTDLEMQIESLNEELAYMKKNHEDELQSFRVGGPGEVSVEMDAAPGVDLTRLLND
MRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQ
SQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKA
RLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNG
EVVSSQVQEIEELM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99456	1.000	1.000	1.723E-64	494	1.000	1.000	Q99456.pdb.gz	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
2	AFDB:Q64291	0.496	0.502	4.218E-47	487	0.785	0.797	Q64291.pdb.gz	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
3	AFDB:Q6IFV1	0.388	0.394	5.890E-32	485	0.530	0.540	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
4	AFDB:Q6IFX1	0.536	0.539	2.628E-31	491	0.553	0.556	Q6IFX1.pdb.gz	K1C24_RAT Keratin, type I cytoskeletal 24 OS=Rattus norvegicus OX=10116 GN=Krt24 PE=3 SV=1
5	AFDB:Q6PVZ1	0.539	0.567	4.846E-31	467	0.524	0.555	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
6	AFDB:P02533	0.446	0.464	5.942E-31	472	0.530	0.555	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
7	AFDB:Q61414	0.458	0.494	8.934E-31	452	0.520	0.569	Q61414.pdb.gz	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
8	AFDB:P19012	0.526	0.567	4.267E-30	456	0.518	0.561	P19012.pdb.gz	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
9	AFDB:Q2M2I5	0.462	0.439	6.415E-30	525	0.553	0.520	Q2M2I5.pdb.gz	K1C24_HUMAN Keratin, type I cytoskeletal 24 OS=Homo sapiens OX=9606 GN=KRT24 PE=1 SV=1
10	AFDB:Q7Z3Y8	0.478	0.508	1.662E-29	459	0.504	0.542	Q7Z3Y8.pdb.gz	K1C27_HUMAN Keratin, type I cytoskeletal 27 OS=Homo sapiens OX=9606 GN=KRT27 PE=1 SV=2
11	PDB:6fhmA	0.048	0.110	2.686	193	0.004	0.010	6fhmA.pdb.gz
12	PDB:6murE	0.049	0.080	3.526	286	0.010	0.017	6murE.pdb.gz	Type III-A CRISPR-Cas Csm Complexes: Assembly, Periodic RNA Cleavage, DNase Activity Regulation, and Autoimmunity.
13	PDB:7egbA	0.046	0.041	3.526	558	0.022	0.020	7egbA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
14	PDB:2ymwB	0.042	0.032	4.039	685	0.008	0.006	2ymwB.pdb.gz
15	PDB:3ul5D	0.045	0.194	4.323	84	0.012	0.071	3ul5D.pdb.gz
16	PDB:7wtwV	0.038	0.166	4.323	83	0.010	0.060	7wtwV.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
17	PDB:3j9zSJ	0.047	0.194	5.301	103	0.016	0.078	3j9zSJ.pdb.gz	Activation of GTP hydrolysis in mRNA-tRNA translocation by elongation factor G.
18	PDB:5hk5F	0.043	0.116	6.073	129	0.008	0.031	5hk5F.pdb.gz
19	PDB:6xywBi	0.046	0.181	6.073	101	0.008	0.040	6xywBi.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
20	PDB:7vbcI	0.038	0.118	6.073	107	0.014	0.065	7vbcI.pdb.gz	Structure of the human RNA polymerase I elongation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q64291	0.0	670	487	0.771	0.782	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
2	Q99456	0.0	989	494	1.000	1.000	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
3	Q6IFU8	5.02e-154	447	433	0.492	0.561	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
4	Q9QWL7	1.44e-153	446	433	0.488	0.557	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
5	Q9Z320	3.56e-153	446	448	0.478	0.527	K1C27_MOUSE Keratin, type I cytoskeletal 27 OS=Mus musculus OX=10090 GN=Krt27 PE=1 SV=1
6	Q04695	4.57e-151	439	432	0.455	0.521	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
7	Q7Z3Y7	2.78e-148	434	464	0.476	0.506	K1C28_HUMAN Keratin, type I cytoskeletal 28 OS=Homo sapiens OX=9606 GN=KRT28 PE=1 SV=2
8	Q7Z3Y8	6.48e-147	430	459	0.441	0.475	K1C27_HUMAN Keratin, type I cytoskeletal 27 OS=Homo sapiens OX=9606 GN=KRT27 PE=1 SV=2
9	P13645	2.48e-146	433	584	0.441	0.373	K1C10_HUMAN Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6
10	Q6PVZ1	1.53e-145	427	467	0.443	0.469	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
11	Q61414	4.48e-145	425	452	0.445	0.487	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
12	P08727	5.65e-145	423	400	0.429	0.530	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
13	Q8VCW2	1.41e-144	424	446	0.474	0.525	K1C25_MOUSE Keratin, type I cytoskeletal 25 OS=Mus musculus OX=10090 GN=Krt25 PE=1 SV=1
14	Q6IFX1	2.51e-144	424	491	0.443	0.446	K1C24_RAT Keratin, type I cytoskeletal 24 OS=Rattus norvegicus OX=10116 GN=Krt24 PE=3 SV=1
15	P02533	6.22e-144	423	472	0.447	0.468	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
16	P08779	1.22e-143	422	473	0.429	0.448	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
17	Q6IFV3	1.76e-143	421	447	0.439	0.485	K1C15_RAT Keratin, type I cytoskeletal 15 OS=Rattus norvegicus OX=10116 GN=Krt15 PE=1 SV=1
18	Q2M2I5	3.27e-143	423	525	0.443	0.417	K1C24_HUMAN Keratin, type I cytoskeletal 24 OS=Homo sapiens OX=9606 GN=KRT24 PE=1 SV=1
19	Q6IFV1	1.03e-142	420	485	0.451	0.460	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
20	K7ERE3	1.60e-142	417	415	0.417	0.496	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10014 2OG-Fe_Oxy_2	6e+02	11.7	2OG-Fe dioxygenase
2	PF07889 DUF1664	6.7e+02	11.7	Protein of unknown function (DUF1664)
3	PF11161 DUF2944	77	14.6	Protein of unknown function (DUF2946)
4	PF14362 DUF4407	5.4e+02	11.3	Domain of unknown function (DUF4407)
5	PF00038 Filament	1.1e-102	355.4	Intermediate filament protein
6	PF09744 Jnk-SapK_ap_N	4.3e+02	12.7	JNK_SAPK-associated protein-1
7	PF07926 TPR_MLP1_2	24	16.4	TPR/MLP1/MLP2-like protein
8	PF06785 UPF0242	9.2e+02	11.3	Uncharacterised protein family (UPF0242) N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251643

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266719	0.689	Keratocan
2	9606.ENSP00000328983	0.666	Carbohydrate sulfotransferase 6
3	9606.ENSP00000382791	0.642	Glutamate receptor ionotropic, kainate 1
4	9606.ENSP00000399805	0.605	Quinone oxidoreductase
5	9606.ENSP00000366006	0.604	UbiA prenyltransferase domain-containing protein 1
6	9606.ENSP00000416606	0.602	Follitropin subunit beta
7	9606.ENSP00000404100	0.561	Paired box protein Pax-6
8	9606.ENSP00000411821	0.561	Aldehyde dehydrogenase, dimeric NADP-preferring
9	9606.ENSP00000416330	0.556	Transforming growth factor-beta-induced protein ig-h3
10	9606.ENSP00000007735	0.544	Keratin, type I cuticular Ha3-I
11	9606.ENSP00000251645	0.535	Keratin, type I cuticular Ha1
12	9606.ENSP00000251646	0.534	Keratin, type I cuticular Ha3-II
13	9606.ENSP00000366984	0.527	Keratin, type I cytoskeletal 40
14	9606.ENSP00000269389	0.517	Secreted and transmembrane protein 1
15	9606.ENSP00000310573	0.516	Keratin, type I cytoskeletal 25
16	9606.ENSP00000329165	0.516	Keratin, type I cuticular Ha6
17	9606.ENSP00000347823	0.515	Keratin, type I cytoskeletal 39
18	9606.ENSP00000377570	0.514	Keratin, type I cuticular Ha4
19	9606.ENSP00000334798	0.510	Keratin, type I cytoskeletal 26
20	9606.ENSP00000246646	0.509	Keratin, type I cuticular Ha8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.718	structural molecule activity
GO:0005200	0.304	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.955	anatomical structure development
GO:0009987	0.950	cellular process
GO:0032501	0.944	multicellular organismal process
GO:0009888	0.857	tissue development
GO:0007275	0.781	multicellular organism development
GO:0048513	0.614	animal organ development
GO:0065007	0.491	biological regulation
GO:0048731	0.428	system development
GO:0048880	0.405	sensory system development
GO:0050896	0.401	response to stimulus
GO:0060429	0.383	epithelium development
GO:0050789	0.372	regulation of biological process
GO:0050794	0.336	regulation of cellular process
GO:0007423	0.331	sensory organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.999	intracellular organelle
GO:0005829	0.999	cytosol
GO:0005615	0.996	extracellular space
GO:0070062	0.981	extracellular exosome
GO:0043232	0.967	intracellular non-membrane-bounded organelle
GO:0043231	0.939	intracellular membrane-bounded organelle
GO:0045111	0.797	intermediate filament cytoskeleton
GO:0005634	0.764	nucleus
GO:0099513	0.764	polymeric cytoskeletal fiber
GO:0005882	0.730	intermediate filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]