StarFunc result for job id Q99459

User Input

>input (802 residues)
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKK
TEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDP
RKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEAR
RLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFR
KLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAP
QISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQD
RILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGA
EGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGL
LGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKA
VQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKG
KTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQV
WEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKIL
LGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQER
EKELQHRYADLLLEKETLKSKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08837	0.395	0.395	3.651E-96	802	0.978	0.978	O08837.pdb.gz	CDC5L_RAT Cell division cycle 5-like protein OS=Rattus norvegicus OX=10116 GN=Cdc5l PE=1 SV=2
2	AFDB:Q9W0R0	0.416	0.411	2.192E-70	814	0.633	0.624	Q9W0R0.pdb.gz	Q9W0R0_DROME Cell division cycle 5, isoform A OS=Drosophila melanogaster OX=7227 GN=Cdc5 PE=1 SV=2
3	AFDB:P92948	0.424	0.407	1.889E-54	844	0.463	0.440	P92948.pdb.gz	CDC5L_ARATH Cell division cycle 5-like protein OS=Arabidopsis thaliana OX=3702 GN=CDC5 PE=1 SV=2
4	PDB:6qdvO	0.281	0.496	2.133E-40	441	0.547	0.995	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
5	AFDB:P39964	0.334	0.353	8.684E-39	757	0.368	0.390	P39964.pdb.gz	CEF1_SCHPO Pre-mRNA-splicing factor cdc5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc5 PE=1 SV=1
6	PDB:6id0L	0.305	0.500	3.604E-38	475	0.585	0.987	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
7	AFDB:Q7KQL1	0.312	0.275	4.890E-36	915	0.358	0.314	Q7KQL1.pdb.gz	Q7KQL1_PLAF7 Pre-mRNA-splicing factor CEF1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1033600 PE=3 SV=1
8	PDB:6iczL	0.283	0.487	5.785E-34	454	0.560	0.989	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
9	PDB:5yzgL	0.250	0.470	9.284E-30	419	0.515	0.986	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
10	AFDB:Q03654	0.269	0.361	3.594E-24	590	0.244	0.332	Q03654.pdb.gz	CEF1_YEAST Pre-mRNA-splicing factor CEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CEF1 PE=1 SV=1
11	PDB:5mqfL	0.245	0.526	1.940E-21	336	0.298	0.711	5mqfL.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
12	PDB:5z56L	0.160	0.367	6.820E-19	342	0.420	0.985	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
13	AFDB:Q57ZS5	0.243	0.266	5.781E-16	727	0.202	0.223	Q57ZS5.pdb.gz	Q57ZS5_TRYB2 Cell division control protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.1P6.150 PE=3 SV=1
14	PDB:6j6gc	0.241	0.435	4.267E-15	436	0.153	0.282	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
15	PDB:6exnO	0.252	0.613	8.879E-15	320	0.160	0.400	6exnO.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
16	PDB:3jb9W	0.204	0.375	5.546E-14	426	0.180	0.338	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
17	PDB:5gmkc	0.241	0.435	3.652E-12	436	0.145	0.266	5gmkc.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
18	AFDB:P10243	0.126	0.134	1.147E-6	752	0.123	0.132	P10243.pdb.gz	MYBA_HUMAN Myb-related protein A OS=Homo sapiens OX=9606 GN=MYBL1 PE=1 SV=2
19	AFDB:P10244	0.129	0.147	3.822E-6	700	0.153	0.176	P10244.pdb.gz	MYBB_HUMAN Myb-related protein B OS=Homo sapiens OX=9606 GN=MYBL2 PE=1 SV=1
20	AFDB:D3ZLC6	0.130	0.147	7.548E-6	704	0.127	0.145	D3ZLC6.pdb.gz	D3ZLC6_RAT MYB proto-oncogene like 2 OS=Rattus norvegicus OX=10116 GN=Mybl2 PE=4 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08837	0.0	1621	802	0.979	0.979	CDC5L_RAT Cell division cycle 5-like protein OS=Rattus norvegicus OX=10116 GN=Cdc5l PE=1 SV=2
2	P92948	0.0	625	844	0.464	0.441	CDC5L_ARATH Cell division cycle 5-like protein OS=Arabidopsis thaliana OX=3702 GN=CDC5 PE=1 SV=2
3	Q99459	0.0	1645	802	1.000	1.000	CDC5L_HUMAN Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2
4	Q9W0R0	0.0	962	814	0.642	0.633	Q9W0R0_DROME Cell division cycle 5, isoform A OS=Drosophila melanogaster OX=7227 GN=Cdc5 PE=1 SV=2
5	P39964	3.50e-142	439	757	0.413	0.437	CEF1_SCHPO Pre-mRNA-splicing factor cdc5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc5 PE=1 SV=1
6	Q7KQL1	3.00e-105	346	915	0.254	0.223	Q7KQL1_PLAF7 Pre-mRNA-splicing factor CEF1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1033600 PE=3 SV=1
7	Q03654	1.24e-69	242	590	0.160	0.217	CEF1_YEAST Pre-mRNA-splicing factor CEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CEF1 PE=1 SV=1
8	Q57ZS5	1.18e-35	147	727	0.107	0.118	Q57ZS5_TRYB2 Cell division control protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.1P6.150 PE=3 SV=1
9	Q9SZC2	2.08e-14	76.3	250	0.050	0.160	Q9SZC2_ARATH MYB transcription factor OS=Arabidopsis thaliana OX=3702 GN=MYB69 PE=1 SV=1
10	Q9SEZ4	6.30e-14	75.9	330	0.059	0.142	MY105_ARATH Transcription factor MYB105 OS=Arabidopsis thaliana OX=3702 GN=MYB105 PE=1 SV=1
11	F4J1R5	1.38e-13	74.7	305	0.060	0.157	F4J1R5_ARATH Myb domain protein 110 OS=Arabidopsis thaliana OX=3702 GN=MYB110 PE=4 SV=1
12	Q6R0C4	4.02e-13	72.4	249	0.051	0.165	MYB52_ARATH Transcription factor MYB52 OS=Arabidopsis thaliana OX=3702 GN=MYB52 PE=2 SV=1
13	Q6GVK7	1.32e-12	70.1	219	0.046	0.169	Q6GVK7_GOSAR Myb family transcription factor 109 OS=Gossypium arboreum OX=29729 GN=MYB109 PE=2 SV=1
14	Q6R032	3.59e-12	72.0	548	0.049	0.071	MB3R5_ARATH Transcription factor MYB3R-5 OS=Arabidopsis thaliana OX=3702 GN=MYB3R5 PE=2 SV=1
15	Q94FL9	6.25e-12	72.0	961	0.046	0.039	MB3R4_ARATH Transcription factor MYB3R-4 OS=Arabidopsis thaliana OX=3702 GN=MYB3R4 PE=1 SV=1
16	Q1PDP9	6.59e-12	70.1	359	0.040	0.089	MY115_ARATH Transcription factor MYB115 OS=Arabidopsis thaliana OX=3702 GN=MYB115 PE=2 SV=1
17	Q0JHU7	9.91e-12	70.9	587	0.045	0.061	MB3R2_ORYSJ Transcription factor MYB3R-2 OS=Oryza sativa subsp. japonica OX=39947 GN=MYB3R-2 PE=2 SV=1
18	Q9LQX5	1.03e-11	69.7	359	0.045	0.100	MY117_ARATH Transcription factor MYB117 OS=Arabidopsis thaliana OX=3702 GN=MYB117 PE=2 SV=1
19	Q9S7L2	1.55e-11	69.7	427	0.046	0.087	MYB98_ARATH Transcription factor MYB98 OS=Arabidopsis thaliana OX=3702 GN=MYB98 PE=2 SV=1
20	Q70SX1	1.69e-11	67.0	234	0.047	0.162	Q70SX1_GOSHI Transcription factor myb109 OS=Gossypium hirsutum OX=3635 GN=myb109 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11831 Myb_Cef	4.4e-79	277.0	pre-mRNA splicing factor component
2	PF00249 Myb_DNA-binding	6.9e-17	72.7	Myb-like DNA-binding domain
3	PF13921 Myb_DNA-bind_6	5.7e-15	66.6	Myb-like DNA-binding domain
4	PF11626 Rap1_C	1.6e+02	13.8	TRF2-interacting telomeric protein/Rap1 - C terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000156471	0.999	Intron-binding protein aquarius
2	9606.ENSP00000199814	0.999	Pre-mRNA-splicing factor RBM22
3	9606.ENSP00000215829	0.999	Small nuclear ribonucleoprotein Sm D3
4	9606.ENSP00000227524	0.999	Pre-mRNA-processing factor 19
5	9606.ENSP00000236273	0.999	Pre-mRNA-splicing factor SYF2
6	9606.ENSP00000254193	0.999	U2 small nuclear ribonucleoprotein A
7	9606.ENSP00000261531	0.999	SNW domain-containing protein 1
8	9606.ENSP00000262415	0.999	ATP-dependent RNA helicase DHX8
9	9606.ENSP00000263694	0.999	U5 small nuclear ribonucleoprotein 40 kDa protein
10	9606.ENSP00000266735	0.999	Small nuclear ribonucleoprotein F
11	9606.ENSP00000300413	0.999	Small nuclear ribonucleoprotein Sm D1
12	9606.ENSP00000301740	0.999	Serine/arginine repetitive matrix protein 2
13	9606.ENSP00000317123	0.999	U5 small nuclear ribonucleoprotein 200 kDa helicase
14	9606.ENSP00000318861	0.999	Splicing factor 3B subunit 2
15	9606.ENSP00000335321	0.999	Splicing factor 3B subunit 1
16	9606.ENSP00000342374	0.999	Small nuclear ribonucleoprotein Sm D2
17	9606.ENSP00000351137	0.999	Pre-mRNA-splicing factor SYF1
18	9606.ENSP00000355050	0.999	Beta-catenin-like protein 1
19	9606.ENSP00000357928	0.999	Pre-mRNA-processing factor 17
20	9606.ENSP00000358554	0.999	Pre-mRNA-splicing factor SPF27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.994	nucleic acid binding
GO:0003677	0.972	DNA binding
GO:0003723	0.944	RNA binding
GO:0043565	0.921	sequence-specific DNA binding
GO:0003690	0.887	double-stranded DNA binding
GO:1990837	0.876	sequence-specific double-stranded DNA binding
GO:0000976	0.865	transcription cis-regulatory region binding
GO:0003700	0.853	DNA-binding transcription factor activity
GO:0019904	0.570	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.995	cellular process
GO:0071704	0.994	organic substance metabolic process
GO:0043170	0.984	macromolecule metabolic process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0044238	0.974	primary metabolic process
GO:0044237	0.974	cellular metabolic process
GO:0006807	0.969	nitrogen compound metabolic process
GO:0019219	0.968	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.966	response to stimulus
GO:0060255	0.953	regulation of macromolecule metabolic process
GO:1901360	0.890	organic cyclic compound metabolic process
GO:0010468	0.880	regulation of gene expression
GO:0006725	0.878	cellular aromatic compound metabolic process
GO:0051252	0.867	regulation of RNA metabolic process
GO:0006139	0.857	nucleobase-containing compound metabolic process
GO:0010467	0.854	gene expression
GO:0010556	0.851	regulation of macromolecule biosynthetic process
GO:0031326	0.851	regulation of cellular biosynthetic process
GO:0090304	0.847	nucleic acid metabolic process
GO:0051716	0.836	cellular response to stimulus
GO:0016070	0.787	RNA metabolic process
GO:0008380	0.781	RNA splicing
GO:0006397	0.772	mRNA processing
GO:2001141	0.767	regulation of RNA biosynthetic process
GO:0006355	0.761	regulation of DNA-templated transcription
GO:0000375	0.754	RNA splicing, via transesterification reactions
GO:0000398	0.740	mRNA splicing, via spliceosome
GO:0006950	0.599	response to stress
GO:0048519	0.599	negative regulation of biological process
GO:0048518	0.497	positive regulation of biological process
GO:0048523	0.470	negative regulation of cellular process
GO:0048522	0.410	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0005737	0.997	cytoplasm
GO:0016607	0.989	nuclear speck
GO:0043232	0.970	intracellular non-membrane-bounded organelle
GO:0032993	0.958	protein-DNA complex
GO:0016020	0.934	membrane
GO:1990904	0.880	ribonucleoprotein complex
GO:0005681	0.859	spliceosomal complex
GO:1902494	0.826	catalytic complex
GO:0005829	0.817	cytosol
GO:0005694	0.599	chromosome
GO:0071013	0.476	catalytic step 2 spliceosome
GO:0071007	0.389	U2-type catalytic step 2 spliceosome
GO:0000974	0.379	Prp19 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]