StarFunc result for job id Q99466

User Input

>input (2003 residues)
MQPPSLLLLLLLLLLLCVSVVRPRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGE
TCQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAKLED
PCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQC
HCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPP
RGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTC
LCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCI
AATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLC
QPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECL
SQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICL
PGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPV
GASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAP
PEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTG
YTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGG
TCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGS
CQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSL
CHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGY
DGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGT
AACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFE
GPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPC
LYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDG
GDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCH
DHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLS
LTLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAG
FVVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAP
PANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRR
RPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGA
LPQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEPWEPLL
DGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAR
EVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHW
AAAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAG
LAPADVAHQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTVSVSVPPHGGGALPR
CRTLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPTPRGRRFSAGM
RGPRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPSPERGS
PQLDCGPPALQEMPINQGGEGKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31695	0.163	0.166	0.000	1964	0.802	0.818	P31695.pdb.gz	NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus OX=10090 GN=Notch4 PE=1 SV=3
2	AFDB:Q99466	1.000	1.000	0.000	2003	1.000	1.000	Q99466.pdb.gz	NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens OX=9606 GN=NOTCH4 PE=1 SV=2
3	AFDB:Q63722	0.070	0.108	6.071E-57	1219	0.146	0.240	Q63722.pdb.gz	JAG1_RAT Protein jagged-1 OS=Rattus norvegicus OX=10116 GN=Jag1 PE=1 SV=2
4	AFDB:Q19350	0.082	0.091	1.229E-55	1722	0.167	0.194	Q19350.pdb.gz	Q19350_CAEEL Drosophila CRumBs homolog OS=Caenorhabditis elegans OX=6239 GN=crb-1 PE=4 SV=1
5	AFDB:P18168	0.065	0.086	4.827E-46	1404	0.147	0.209	P18168.pdb.gz	SERR_DROME Protein serrate OS=Drosophila melanogaster OX=7227 GN=Ser PE=1 SV=3
6	AFDB:A0A0R4IBP9	0.064	0.107	1.017E-26	1010	0.093	0.184	A0A0R4IBP9.pdb.gz
7	AFDB:A0A2R8QDY6	0.059	0.069	5.233E-25	1532	0.068	0.089	A0A2R8QDY6.pdb.gz
8	AFDB:P97582	0.110	0.260	1.670E-15	843	0.037	0.088	P97582.pdb.gz	P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
9	AFDB:Q8NFD2	0.113	0.290	3.278E-15	765	0.039	0.102	Q8NFD2.pdb.gz	ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1
10	AFDB:Q8BZ25	0.108	0.286	2.894E-14	745	0.041	0.111	Q8BZ25.pdb.gz	ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankk1 PE=2 SV=1
11	PDB:8cs9A	0.105	0.250	3.963E-14	796	0.040	0.102	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:2dvwA	0.093	0.770	5.876E-13	229	0.030	0.266	2dvwA.pdb.gz
13	PDB:1wg0A	0.097	0.727	3.461E-10	243	0.031	0.255	1wg0A.pdb.gz
14	PDB:5vkqA	0.107	0.141	4.725E-10	1499	0.035	0.047	5vkqA.pdb.gz
15	PDB:4oauC	0.098	0.273	7.154E-10	692	0.032	0.094	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
16	PDB:6aunA	0.071	0.204	7.772E-9	618	0.026	0.084	6aunA.pdb.gz
17	PDB:6v9hC	0.097	0.664	7.772E-9	270	0.027	0.204	6v9hC.pdb.gz
18	PDB:6jd6B	0.075	0.742	2.698E-8	192	0.022	0.229	6jd6B.pdb.gz
19	PDB:1bd8A	0.067	0.664	8.017E-8	156	0.022	0.288	1bd8A.pdb.gz
20	PDB:6e2fC	0.089	0.267	1.153E-7	647	0.028	0.088	6e2fC.pdb.gz	Mechanism of calmodulin inactivation of the calcium-selective TRP channel TRPV6.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0PGH6	0.0	1172	2465	0.364	0.296	A0PGH6_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=wu:fc55e11 PE=2 SV=1
2	A2RUV0	0.0	1163	2522	0.382	0.303	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
3	F1RCH4	0.0	1017	2475	0.347	0.281	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
4	G3I6Z6	0.0	1200	2527	0.377	0.299	NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2
5	O35516	0.0	1129	2473	0.356	0.289	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
6	P07207	0.0	1056	2703	0.341	0.253	NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3
7	P21783	0.0	1160	2524	0.377	0.299	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
8	P31695	0.0	2966	1964	0.797	0.813	NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus OX=10090 GN=Notch4 PE=1 SV=3
9	P46530	0.0	1150	2437	0.365	0.300	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
10	P46531	0.0	1177	2555	0.378	0.297	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
11	Q01705	0.0	1202	2531	0.379	0.300	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
12	Q04721	0.0	1120	2471	0.357	0.289	NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3
13	Q07008	0.0	1194	2531	0.377	0.298	NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3
14	Q61982	0.0	1073	2318	0.365	0.315	NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus OX=10090 GN=Notch3 PE=1 SV=1
15	Q800E4	0.0	1110	2468	0.363	0.295	Q800E4_DANRE Neurogenic locus notch homolog protein 3 precursor OS=Danio rerio OX=7955 GN=fa14b08 PE=1 SV=1
16	Q99466	0.0	3961	2003	1.000	1.000	NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens OX=9606 GN=NOTCH4 PE=1 SV=2
17	Q9QW30	0.0	1113	2471	0.359	0.291	NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus OX=10116 GN=Notch2 PE=1 SV=1
18	Q9R172	0.0	1075	2319	0.367	0.317	NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus OX=10116 GN=Notch3 PE=2 SV=2
19	Q9UM47	0.0	1053	2321	0.367	0.317	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2
20	B8JI71	3.22e-170	582	2904	0.211	0.146	EYS_DANRE Protein eyes shut homolog OS=Danio rerio OX=7955 GN=eys PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.6e-24	95.3	Ankyrin repeat
2	PF12796 Ank_2	1.3e-23	94.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	4.1e-17	71.4	Ankyrin repeat
4	PF13637 Ank_4	2e-16	71.4	Ankyrin repeats (many copies)
5	PF13857 Ank_5	6e-23	91.9	Ankyrin repeats (many copies)
6	PF12662 cEGF	25	16.2	Complement Clr-like EGF-like
7	PF00008 EGF	3.5e-115	387.0	EGF-like domain
8	PF07974 EGF_2	0.04	25.6	EGF-like domain
9	PF12947 EGF_3	1.4e-14	65.3	EGF domain
10	PF07645 EGF_CA	8.7e-36	133.2	Calcium-binding EGF domain
11	PF12661 hEGF	5.7e-69	237.9	Human growth factor-like EGF
12	PF06816 NOD	0.16	22.7	NOTCH protein
13	PF07684 NODP	7.7e-05	34.0	NOTCH protein
14	PF00066 Notch	1e-20	85.2	LNR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364163

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345206	0.984	Recombining binding protein suppressor of hairless
2	9606.ENSP00000338272	0.980	Hairy/enhancer-of-split related with YRPW motif protein 1
3	9606.ENSP00000357348	0.973	Hairy/enhancer-of-split related with YRPW motif protein 2
4	9606.ENSP00000367714	0.961	Transcription factor HES-5
5	9606.ENSP00000281708	0.956	F-box/WD repeat-containing protein 7
6	9606.ENSP00000292599	0.955	Mastermind-like protein 1
7	9606.ENSP00000421180	0.952	Mastermind-like protein 3
8	9606.ENSP00000232424	0.951	Transcription factor HES-1
9	9606.ENSP00000294785	0.951	Nicastrin
10	9606.ENSP00000326366	0.950	Presenilin-1
11	9606.ENSP00000249749	0.949	Delta-like protein 4
12	9606.ENSP00000355747	0.946	Presenilin-2
13	9606.ENSP00000260408	0.944	Disintegrin and metalloproteinase domain-containing protein 10
14	9606.ENSP00000364902	0.944	GDP-fucose protein O-fucosyltransferase 1
15	9606.ENSP00000222725	0.942	Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe
16	9606.ENSP00000261937	0.940	Vascular endothelial growth factor receptor 3
17	9606.ENSP00000349490	0.939	Beta-1,3-N-acetylglucosaminyltransferase manic fringe
18	9606.ENSP00000358105	0.939	Gamma-secretase subunit APH-1A
19	9606.ENSP00000451828	0.939	RAC-alpha serine/threonine-protein kinase
20	9606.ENSP00000434552	0.938	Mastermind-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0005509	0.994	calcium ion binding
GO:0019899	0.535	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0048856	0.991	anatomical structure development
GO:0050794	0.988	regulation of cellular process
GO:0050896	0.985	response to stimulus
GO:0007275	0.983	multicellular organism development
GO:0019222	0.946	regulation of metabolic process
GO:0007219	0.920	Notch signaling pathway
GO:0009653	0.904	anatomical structure morphogenesis
GO:0048869	0.901	cellular developmental process
GO:0048731	0.901	system development
GO:0003158	0.895	endothelium development
GO:0048519	0.874	negative regulation of biological process
GO:0030154	0.869	cell differentiation
GO:0048523	0.860	negative regulation of cellular process
GO:0048518	0.854	positive regulation of biological process
GO:0060255	0.832	regulation of macromolecule metabolic process
GO:0051171	0.806	regulation of nitrogen compound metabolic process
GO:0080090	0.805	regulation of primary metabolic process
GO:0048522	0.794	positive regulation of cellular process
GO:0010468	0.793	regulation of gene expression
GO:0010604	0.766	positive regulation of macromolecule metabolic process
GO:0031323	0.761	regulation of cellular metabolic process
GO:0051173	0.703	positive regulation of nitrogen compound metabolic process
GO:0010556	0.681	regulation of macromolecule biosynthetic process
GO:0031326	0.678	regulation of cellular biosynthetic process
GO:0019219	0.655	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.651	regulation of RNA metabolic process
GO:0031325	0.649	positive regulation of cellular metabolic process
GO:0010605	0.644	negative regulation of macromolecule metabolic process
GO:0048513	0.643	animal organ development
GO:1903506	0.635	regulation of nucleic acid-templated transcription
GO:0006355	0.634	regulation of DNA-templated transcription
GO:0006950	0.513	response to stress
GO:0048583	0.508	regulation of response to stimulus
GO:0006357	0.494	regulation of transcription by RNA polymerase II
GO:0023051	0.451	regulation of signaling
GO:0045935	0.449	positive regulation of nucleobase-containing compound metabolic process
GO:0051172	0.448	negative regulation of nitrogen compound metabolic process
GO:0048468	0.446	cell development
GO:0051254	0.440	positive regulation of RNA metabolic process
GO:0010646	0.438	regulation of cell communication
GO:0051246	0.402	regulation of protein metabolic process
GO:0010558	0.386	negative regulation of macromolecule biosynthetic process
GO:0045893	0.374	positive regulation of DNA-templated transcription
GO:0031327	0.372	negative regulation of cellular biosynthetic process
GO:0009966	0.328	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0012505	0.999	endomembrane system
GO:0005886	0.999	plasma membrane
GO:0005829	0.999	cytosol
GO:0005783	0.989	endoplasmic reticulum
GO:0005576	0.963	extracellular region
GO:0032991	0.944	protein-containing complex
GO:0031982	0.909	vesicle
GO:0031090	0.878	organelle membrane
GO:0031410	0.825	cytoplasmic vesicle
GO:0098588	0.813	bounding membrane of organelle
GO:0005794	0.611	Golgi apparatus
GO:0000139	0.557	Golgi membrane
GO:0031984	0.520	organelle subcompartment
GO:0005789	0.505	endoplasmic reticulum membrane
GO:0009986	0.434	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]