StarFunc result for job id Q99467

User Input

>input (661 residues)
MAFDVSCFFWVVLFSAGCKVITSWDQMCIEKEANKTYNCENLGLSEIPDTLPNTTEFLEF
SFNFLPTIHNRTFSRLMNLTFLDLTRCQINWIHEDTFQSHHQLSTLVLTGNPLIFMAETS
LNGPKSLKHLFLIQTGISNLEFIPVHNLENLESLYLGSNHISSIKFPKDFPARNLKVLDF
QNNAIHYISREDMRSLEQAINLSLNFNGNNVKGIELGAFDSTIFQSLNFGGTPNLSVIFN
GLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQEHRFSDISSTTFQCFTQL
QELDLTATHLKGLPSGMKGLNLLKKLVLSVNHFDQLCQISAANFPSLTHLYIRGNVKKLH
LGVGCLEKLGNLQTLDLSHNDIEASDCCSLQLKNLSHLQTLNLSHNEPLGLQSQAFKECP
QLELLDLAFTRLHINAPQSPFQNLHFLQVLNLTYCFLDTSNQHLLAGLPVLRHLNLKGNH
FQDGTITKTNLLQTVGSLEVLILSSCGLLSIDQQAFHSLGKMSHVDLSHNSLTCDSIDSL
SHLKGIYLNLAANSINIISPRLLPILSQQSTINLSHNPLDCTCSNIHFLTWYKENLHKLE
GSEETTCANPPSLRGVKLSDVKLSCGITAIGIFFLIVFLLLLAILLFFAVKYLLRWKYQH
I

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99467	1.000	1.000	0.000	661	1.000	1.000	Q99467.pdb.gz	CD180_HUMAN CD180 antigen OS=Homo sapiens OX=9606 GN=CD180 PE=1 SV=2
2	AFDB:Q0V8G5	0.923	0.923	8.068E-89	661	0.770	0.770	Q0V8G5.pdb.gz	Q0V8G5_BOVIN CD180 antigen OS=Bos taurus OX=9913 GN=CD180 PE=1 SV=1
3	PDB:3b2dA	0.890	0.977	7.064E-87	601	0.909	1.000	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
4	AFDB:Q62192	0.929	0.929	1.600E-83	661	0.738	0.738	Q62192.pdb.gz	CD180_MOUSE CD180 antigen OS=Mus musculus OX=10090 GN=Cd180 PE=1 SV=2
5	PDB:3t6qA	0.891	0.979	3.986E-76	601	0.673	0.740	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
6	AFDB:A0A0A8P613	0.842	0.837	4.333E-48	665	0.381	0.379	A0A0A8P613.pdb.gz
7	AFDB:Q7ZTG5	0.794	0.634	1.556E-37	843	0.287	0.225	Q7ZTG5.pdb.gz	Q7ZTG5_CHICK TLR4 OS=Gallus gallus OX=9031 GN=TLR4 PE=3 SV=1
8	AFDB:Q9QX05	0.730	0.589	3.691E-33	835	0.259	0.205	Q9QX05.pdb.gz	TLR4_RAT Toll-like receptor 4 OS=Rattus norvegicus OX=10116 GN=Tlr4 PE=2 SV=1
9	AFDB:B8A691	0.769	0.633	4.040E-33	819	0.283	0.228	B8A691.pdb.gz	B8A691_DANRE Toll-like receptor 4b, duplicate b OS=Danio rerio OX=7955 GN=tlr4b PE=3 SV=1
10	AFDB:O00206	0.726	0.586	2.949E-32	839	0.278	0.219	O00206.pdb.gz	TLR4_HUMAN Toll-like receptor 4 OS=Homo sapiens OX=9606 GN=TLR4 PE=1 SV=2
11	AFDB:Q9QUK6	0.733	0.592	1.045E-31	835	0.265	0.210	Q9QUK6.pdb.gz	TLR4_MOUSE Toll-like receptor 4 OS=Mus musculus OX=10090 GN=Tlr4 PE=1 SV=1
12	AFDB:B8A689	0.750	0.640	2.362E-29	787	0.254	0.213	B8A689.pdb.gz
13	PDB:7wv3A	0.671	0.665	1.738E-22	668	0.221	0.219	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
14	PDB:3j0aA	0.528	0.452	7.771E-17	797	0.209	0.173	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
15	PDB:6gffI	0.304	0.345	4.538E-14	551	0.197	0.236	6gffI.pdb.gz
16	PDB:7wrqA	0.450	0.515	1.764E-11	566	0.210	0.246	7wrqA.pdb.gz
17	PDB:7tvfD	0.369	0.457	5.232E-9	515	0.156	0.200	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
18	PDB:7p5vB	0.327	0.303	2.546E-7	732	0.132	0.119	7p5vB.pdb.gz
19	PDB:1xcdA	0.151	0.270	3.192E-7	305	0.115	0.249	1xcdA.pdb.gz
20	PDB:1a4yA	0.313	0.404	5.014E-7	460	0.126	0.180	1a4yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0V8G5	0.0	1021	661	0.779	0.779	Q0V8G5_BOVIN CD180 antigen OS=Bos taurus OX=9913 GN=CD180 PE=1 SV=1
2	Q62192	0.0	999	661	0.740	0.740	CD180_MOUSE CD180 antigen OS=Mus musculus OX=10090 GN=Cd180 PE=1 SV=2
3	Q99467	0.0	1333	661	1.000	1.000	CD180_HUMAN CD180 antigen OS=Homo sapiens OX=9606 GN=CD180 PE=1 SV=2
4	Q7ZTG5	6.68e-65	231	843	0.295	0.231	Q7ZTG5_CHICK TLR4 OS=Gallus gallus OX=9031 GN=TLR4 PE=3 SV=1
5	B8A691	5.44e-62	223	819	0.298	0.241	B8A691_DANRE Toll-like receptor 4b, duplicate b OS=Danio rerio OX=7955 GN=tlr4b PE=3 SV=1
6	Q6TS41	5.55e-62	223	819	0.298	0.241	Q6TS41_DANRE Toll-like receptor 4b OS=Danio rerio OX=7955 GN=tlr4bb PE=2 SV=1
7	Q9QUK6	3.26e-56	207	835	0.277	0.219	TLR4_MOUSE Toll-like receptor 4 OS=Mus musculus OX=10090 GN=Tlr4 PE=1 SV=1
8	Q9QX05	2.93e-53	198	835	0.263	0.208	TLR4_RAT Toll-like receptor 4 OS=Rattus norvegicus OX=10116 GN=Tlr4 PE=2 SV=1
9	O00206	1.22e-50	191	839	0.278	0.219	TLR4_HUMAN Toll-like receptor 4 OS=Homo sapiens OX=9606 GN=TLR4 PE=1 SV=2
10	B3U3W0	4.31e-42	165	750	0.247	0.217	B3U3W0_DANRE Toll-like receptor 4a OS=Danio rerio OX=7955 GN=TIR4.1 PE=2 SV=1
11	O15455	2.70e-25	114	904	0.278	0.204	TLR3_HUMAN Toll-like receptor 3 OS=Homo sapiens OX=9606 GN=TLR3 PE=1 SV=1
12	Q6PCD4	2.79e-25	114	870	0.278	0.211	Q6PCD4_HUMAN TLR3 protein (Fragment) OS=Homo sapiens OX=9606 GN=TLR3 PE=2 SV=1
13	F8W3J5	9.86e-23	105	881	0.265	0.199	F8W3J5_DANRE Toll-like receptor 5b OS=Danio rerio OX=7955 GN=tlr5 PE=1 SV=1
14	Q7TNI8	2.95e-22	104	905	0.286	0.209	Q7TNI8_RAT Toll-like receptor 3 OS=Rattus norvegicus OX=10116 GN=Tlr3 PE=2 SV=1
15	B3DIN1	6.74e-22	103	875	0.262	0.198	B3DIN1_DANRE Tlr5b protein OS=Danio rerio OX=7955 GN=tlr5b PE=1 SV=1
16	Q0PQ88	1.93e-20	98.6	896	0.253	0.186	Q0PQ88_CHICK Toll-like receptor 3 OS=Gallus gallus OX=9031 GN=TLR3 PE=2 SV=2
17	A0A2R8RTN4	4.39e-19	94.4	955	0.268	0.185	A0A2R8RTN4_DANRE Toll-like receptor 22 OS=Danio rerio OX=7955 GN=TLR21.2 PE=3 SV=1
18	F1LN63	8.32e-19	93.6	905	0.213	0.156	F1LN63_RAT Toll-like receptor 3 OS=Rattus norvegicus OX=10116 GN=Tlr3 PE=3 SV=1
19	A0A0G2JXV2	1.11e-18	93.2	927	0.213	0.152	A0A0G2JXV2_RAT Toll-like receptor 3 OS=Rattus norvegicus OX=10116 GN=Tlr3 PE=1 SV=1
20	F8W4F1	1.35e-17	89.7	881	0.263	0.198	F8W4F1_DANRE Toll-like receptor 5 OS=Danio rerio OX=7955 GN=tlr5a PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01463 LRRCT	1.7e+02	14.2	Leucine rich repeat C-terminal domain
2	PF00560 LRR_1	0.00061	30.7	Leucine Rich Repeat
3	PF18831 LRR_11	1.2e-13	61.7	Leucine-rich repeat
4	PF12799 LRR_4	3.5e-15	67.1	Leucine Rich repeats (2 copies)
5	PF13516 LRR_6	2.8e+02	13.1	Leucine Rich repeat
6	PF13855 LRR_8	1.4e-44	160.9	Leucine rich repeat
7	PF14580 LRR_9	10	17.1	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256447

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369286	0.999	Lymphocyte antigen 86
2	9606.ENSP00000284818	0.977	Lymphocyte antigen 96
3	9606.ENSP00000363089	0.937	Toll-like receptor 4
4	9606.ENSP00000304236	0.918	Monocyte differentiation antigen CD14
5	9606.ENSP00000260010	0.603	Toll-like receptor 2
6	9606.ENSP00000274000	0.598	AP-1 complex-associated regulatory protein
7	9606.ENSP00000376544	0.593	B-cell antigen receptor complex-associated protein beta chain
8	9606.ENSP00000401399	0.558	Myeloid differentiation primary response protein MyD88
9	9606.ENSP00000361207	0.537	Growth hormone-inducible transmembrane protein
10	9606.ENSP00000296785	0.525	Ankyrin repeat family A protein 2
11	9606.ENSP00000357981	0.503	Cathepsin S

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0048583	0.980	regulation of response to stimulus
GO:0009987	0.975	cellular process
GO:0050896	0.973	response to stimulus
GO:0048522	0.969	positive regulation of cellular process
GO:0048584	0.959	positive regulation of response to stimulus
GO:0002833	0.899	positive regulation of response to biotic stimulus
GO:0023051	0.891	regulation of signaling
GO:0010646	0.891	regulation of cell communication
GO:0032103	0.839	positive regulation of response to external stimulus
GO:0002376	0.804	immune system process
GO:0009966	0.769	regulation of signal transduction
GO:0051716	0.740	cellular response to stimulus
GO:0023056	0.716	positive regulation of signaling
GO:0010647	0.716	positive regulation of cell communication
GO:0007154	0.699	cell communication
GO:0009967	0.698	positive regulation of signal transduction
GO:0023052	0.638	signaling
GO:0007165	0.592	signal transduction
GO:0002682	0.569	regulation of immune system process
GO:0006955	0.536	immune response
GO:0009607	0.482	response to biotic stimulus
GO:0044419	0.477	biological process involved in interspecies interaction between organisms
GO:0019222	0.463	regulation of metabolic process
GO:0043207	0.460	response to external biotic stimulus
GO:0032501	0.459	multicellular organismal process
GO:0002684	0.456	positive regulation of immune system process
GO:0042221	0.455	response to chemical
GO:0051707	0.441	response to other organism
GO:0050778	0.431	positive regulation of immune response
GO:0031347	0.419	regulation of defense response
GO:0007166	0.413	cell surface receptor signaling pathway
GO:0051239	0.412	regulation of multicellular organismal process
GO:0060255	0.400	regulation of macromolecule metabolic process
GO:0006950	0.358	response to stress
GO:0031349	0.350	positive regulation of defense response
GO:0048519	0.346	negative regulation of biological process
GO:0006952	0.324	defense response
GO:0010033	0.322	response to organic substance
GO:0002253	0.321	activation of immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.976	organelle
GO:0043227	0.968	membrane-bounded organelle
GO:0043229	0.966	intracellular organelle
GO:0043231	0.947	intracellular membrane-bounded organelle
GO:0031982	0.886	vesicle
GO:0005737	0.711	cytoplasm
GO:0031974	0.643	membrane-enclosed lumen
GO:0043233	0.591	organelle lumen
GO:0070013	0.544	intracellular organelle lumen
GO:0005634	0.509	nucleus
GO:0043228	0.491	non-membrane-bounded organelle
GO:0031981	0.485	nuclear lumen
GO:0043232	0.439	intracellular non-membrane-bounded organelle
GO:0012505	0.416	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]