StarFunc result for job id Q99469

User Input

>input (402 residues)
MIPPSSPREDGVDGLPKEAVGAEQPPSPASTSSQESKLQKLKRSLSFKTKSLRSKSADNF
FQRTNSEDMKLQAHMVAEISPSSSPLPAPGSLTSTPARAGLHPGGKAHAFQEYIFKKPTF
CDVCNHMIVGTNAKHGLRCKACKMSIHHKCTDGLAPQRCMGKLPKGFRRYYSSPLLIHEQ
FGCIKEVMPIACGNKVDPVYETLRFGTSLAQRTKKGSSGSGSDSPHRTSTSDLVEVPEEA
NGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTYVALYKFVPQE
NEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLQQNEKIFRCVRTFIGCKE
QGQITLKENQICVSSEEEQDGFIRVLSGKKKGLIPLDVLENI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WUK8	0.461	0.461	2.372E-61	402	0.998	0.998	Q8WUK8.pdb.gz	Q8WUK8_HUMAN SH3 and cysteine rich domain OS=Homo sapiens OX=9606 GN=STAC PE=1 SV=1
2	AFDB:P97306	0.596	0.595	2.205E-54	403	0.833	0.831	P97306.pdb.gz	STAC_MOUSE SH3 and cysteine-rich domain-containing protein OS=Mus musculus OX=10090 GN=Stac PE=1 SV=1
3	AFDB:E1BIM8	0.152	0.094	1.027E-6	688	0.172	0.100	E1BIM8.pdb.gz	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
4	AFDB:Q9BX66	0.137	0.044	1.283E-6	1292	0.206	0.064	Q9BX66.pdb.gz	SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3
5	PDB:2lqnA	0.139	0.182	1.998E-6	303	0.077	0.102	2lqnA.pdb.gz
6	AFDB:A0A0B4K774	0.149	0.128	1.118E-5	477	0.132	0.111	A0A0B4K774.pdb.gz	A0A0B4K774_DROME Abelson interacting protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
7	PDB:2dybA	0.139	0.186	2.057E-5	298	0.062	0.084	2dybA.pdb.gz
8	AFDB:Q10929	0.135	0.116	6.252E-5	469	0.137	0.117	Q10929.pdb.gz	Q10929_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abi-1 PE=1 SV=2
9	AFDB:Q66IV2	0.143	0.114	6.986E-5	503	0.147	0.117	Q66IV2.pdb.gz	Q66IV2_XENLA Abl interactor 1 S homeolog OS=Xenopus laevis OX=8355 GN=abi1.S PE=2 SV=1
10	AFDB:P62484	0.143	0.129	1.217E-4	446	0.119	0.108	P62484.pdb.gz	ABI2_MOUSE Abl interactor 2 OS=Mus musculus OX=10090 GN=Abi2 PE=1 SV=1
11	AFDB:O43150	0.152	0.065	1.438E-4	1006	0.132	0.053	O43150.pdb.gz	ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2 PE=1 SV=3
12	PDB:1griA	0.139	0.259	1.518E-4	211	0.052	0.100	1griA.pdb.gz
13	PDB:1k9aB	0.136	0.124	1.605E-4	441	0.057	0.052	1k9aB.pdb.gz
14	AFDB:A0A0S3NTN0	0.138	0.074	1.607E-4	784	0.144	0.074	A0A0S3NTN0.pdb.gz
15	PDB:4mt6A	0.127	0.132	4.359E-4	389	0.060	0.062	4mt6A.pdb.gz
16	PDB:3ehqA	0.137	0.296	4.871E-4	182	0.047	0.104	3ehqA.pdb.gz
17	PDB:6x5hA	0.138	0.118	5.443E-4	467	0.037	0.032	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
18	PDB:2h8hA	0.143	0.130	8.029E-4	445	0.050	0.045	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
19	PDB:3qwyA	0.140	0.325	1.060E-3	170	0.047	0.112	3qwyA.pdb.gz
20	PDB:1k0xA	0.131	0.456	1.563E-3	108	0.050	0.185	1k0xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97306	0.0	681	403	0.833	0.831	STAC_MOUSE SH3 and cysteine-rich domain-containing protein OS=Mus musculus OX=10090 GN=Stac PE=1 SV=1
2	Q8WUK8	0.0	835	402	0.998	0.998	Q8WUK8_HUMAN SH3 and cysteine rich domain OS=Homo sapiens OX=9606 GN=STAC PE=1 SV=1
3	Q99469	0.0	837	402	1.000	1.000	STAC_HUMAN SH3 and cysteine-rich domain-containing protein OS=Homo sapiens OX=9606 GN=STAC PE=1 SV=1
4	Q6ZMT1	3.23e-98	300	411	0.460	0.450	STAC2_HUMAN SH3 and cysteine-rich domain-containing protein 2 OS=Homo sapiens OX=9606 GN=STAC2 PE=1 SV=1
5	Q8R1B0	1.14e-96	296	408	0.465	0.458	STAC2_MOUSE SH3 and cysteine-rich domain-containing protein 2 OS=Mus musculus OX=10090 GN=Stac2 PE=1 SV=1
6	Q96MF2	2.36e-72	232	364	0.301	0.332	STAC3_HUMAN SH3 and cysteine-rich domain-containing protein 3 OS=Homo sapiens OX=9606 GN=STAC3 PE=1 SV=1
7	Q8BZ71	1.36e-69	225	360	0.303	0.339	STAC3_MOUSE SH3 and cysteine-rich domain-containing protein 3 OS=Mus musculus OX=10090 GN=Stac3 PE=1 SV=1
8	Q6DBR6	1.19e-67	219	334	0.291	0.350	STAC3_DANRE SH3 and cysteine-rich domain-containing protein 3 OS=Danio rerio OX=7955 GN=stac3 PE=1 SV=1
9	G3V5D4	2.83e-23	97.4	168	0.109	0.262	G3V5D4_HUMAN SH3 and cysteine rich domain 3 (Fragment) OS=Homo sapiens OX=9606 GN=STAC3 PE=1 SV=1
10	A8DYE9	1.52e-16	83.6	546	0.090	0.066	A8DYE9_DROME Stac-like, isoform E OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=2
11	A0A0B4KFR2	7.64e-16	82.0	1951	0.090	0.018	A0A0B4KFR2_DROME Stac-like, isoform I OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
12	A0A0B4LGK0	8.01e-16	82.0	1198	0.090	0.030	A0A0B4LGK0_DROME Stac-like, isoform V OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
13	A0A0B4KEV7	8.45e-16	82.0	1970	0.090	0.018	A0A0B4KEV7_DROME Stac-like, isoform J OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
14	A0A0B4KG20	8.70e-16	82.0	1166	0.090	0.031	A0A0B4KG20_DROME Stac-like, isoform H OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
15	A0A0B4KER3	9.07e-16	81.6	1156	0.090	0.031	A0A0B4KER3_DROME Stac-like, isoform O OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
16	A0A0B4LFI1	1.08e-15	81.6	1089	0.090	0.033	A0A0B4LFI1_DROME Stac-like, isoform U OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
17	A0A0D9SF54	1.44e-11	68.9	2457	0.100	0.016	A0A0D9SF54_HUMAN Spectrin alpha, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=1
18	A0A384P5S9	1.44e-11	68.9	2452	0.100	0.016	A0A384P5S9_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
19	A0A0D9SGF6	2.86e-11	68.2	2498	0.087	0.014	A0A0D9SGF6_HUMAN Spectrin alpha, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=1
20	P07751	2.86e-11	68.2	2477	0.087	0.014	SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus OX=9031 GN=SPTAN1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08201 BssC_TutF	1.9e+02	13.5	BssC/TutF protein
2	PF00130 C1_1	3e-07	41.5	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF03107 C1_2	51	15.6	C1 domain
4	PF00628 PHD	9.2e+02	11.2	PHD-finger
5	PF02150 RNA_POL_M_15KD	3e+02	12.7	RNA polymerases M/15 Kd subunit
6	PF00018 SH3_1	2.5e-12	57.5	SH3 domain
7	PF07653 SH3_2	1.4e-11	55.3	Variant SH3 domain
8	PF14604 SH3_9	1.8e-13	61.5	Variant SH3 domain
9	PF16664 STAC2_u1	4.7e-28	109.5	Unstructured on SH3 and cysteine-rich domain-containing protein 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273183

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000412927	0.946	HLA class I histocompatibility antigen, alpha chain G
2	9606.ENSP00000386722	0.872	FCH and double SH3 domains 2
3	9606.ENSP00000256649	0.871	Tripartite motif-containing protein 45
4	9606.ENSP00000414147	0.856	Spartin
5	9606.ENSP00000339634	0.803	Killer cell immunoglobulin-like receptor 2DL4
6	9606.ENSP00000375608	0.788	Killer cell immunoglobulin-like receptor 3DL1
7	9606.ENSP00000375629	0.750	Leukocyte immunoglobulin-like receptor subfamily B member 2
8	9606.ENSP00000291860	0.735	Killer cell immunoglobulin-like receptor 3DL3
9	9606.ENSP00000336769	0.733	Killer cell immunoglobulin-like receptor 2DL1
10	9606.ENSP00000325525	0.719	Killer cell immunoglobulin-like receptor 3DL2
11	9606.ENSP00000289902	0.690	High affinity immunoglobulin epsilon receptor subunit gamma
12	9606.ENSP00000264335	0.687	14-3-3 protein epsilon
13	9606.ENSP00000342215	0.665	Killer cell immunoglobulin-like receptor 2DL3
14	9606.ENSP00000247461	0.662	Calnexin
15	9606.ENSP00000266970	0.651	Cyclin-dependent kinase 2
16	9606.ENSP00000429562	0.644	Protein unc-13 homolog A
17	9606.ENSP00000269305	0.638	Cellular tumor antigen p53
18	9606.ENSP00000334198	0.606	Voltage-dependent T-type calcium channel subunit alpha-1H
19	9606.ENSP00000252825	0.601	Sarcoplasmic reticulum histidine-rich calcium-binding protein
20	9606.ENSP00000352011	0.594	Voltage-dependent T-type calcium channel subunit alpha-1G

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.978	cellular process
GO:0050896	0.968	response to stimulus
GO:0048518	0.932	positive regulation of biological process
GO:0048522	0.899	positive regulation of cellular process
GO:0010959	0.877	regulation of metal ion transport
GO:0051924	0.863	regulation of calcium ion transport
GO:0032501	0.843	multicellular organismal process
GO:0051716	0.763	cellular response to stimulus
GO:1903169	0.722	regulation of calcium ion transmembrane transport
GO:0051928	0.695	positive regulation of calcium ion transport
GO:1904427	0.671	positive regulation of calcium ion transmembrane transport
GO:0065009	0.669	regulation of molecular function
GO:0006950	0.663	response to stress
GO:2001259	0.644	positive regulation of cation channel activity
GO:1903076	0.618	regulation of protein localization to plasma membrane
GO:1901019	0.614	regulation of calcium ion transmembrane transporter activity
GO:1904377	0.556	positive regulation of protein localization to cell periphery
GO:1901021	0.546	positive regulation of calcium ion transmembrane transporter activity
GO:1901385	0.488	regulation of voltage-gated calcium channel activity
GO:1903078	0.485	positive regulation of protein localization to plasma membrane
GO:0007154	0.331	cell communication
GO:0048583	0.321	regulation of response to stimulus
GO:0023052	0.310	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.896	organelle
GO:0098552	0.892	side of membrane
GO:0005737	0.888	cytoplasm
GO:0019897	0.811	extrinsic component of plasma membrane
GO:0031234	0.781	extrinsic component of cytoplasmic side of plasma membrane
GO:0043227	0.774	membrane-bounded organelle
GO:0043229	0.763	intracellular organelle
GO:0043231	0.681	intracellular membrane-bounded organelle
GO:0005829	0.659	cytosol
GO:0042383	0.464	sarcolemma
GO:0030315	0.375	T-tubule
GO:0032991	0.357	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]