StarFunc result for job id Q99471

User Input

>input (154 residues)
MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGK
ELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPA
LQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H3BPF6	0.959	0.947	3.883E-21	156	0.922	0.910	H3BPF6.pdb.gz	H3BPF6_HUMAN Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2
2	AFDB:Q04493	0.924	0.876	5.041E-14	163	0.370	0.350	Q04493.pdb.gz	PFD5_YEAST Prefoldin subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIM5 PE=1 SV=1
3	AFDB:O94307	0.904	0.904	1.214E-13	154	0.409	0.409	O94307.pdb.gz	PFD5_SCHPO Probable prefoldin subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bob1 PE=1 SV=1
4	AFDB:Q9VCZ8	0.898	0.827	2.005E-13	168	0.351	0.321	Q9VCZ8.pdb.gz	PFD5_DROME Probable prefoldin subunit 5 OS=Drosophila melanogaster OX=7227 GN=Pfdn5 PE=1 SV=1
5	AFDB:P57742	0.873	0.890	1.693E-12	151	0.325	0.331	P57742.pdb.gz	PFD5_ARATH Prefoldin subunit 5 OS=Arabidopsis thaliana OX=3702 GN=PFD5 PE=1 SV=1
6	AFDB:Q9VJP9	0.797	0.760	1.424E-8	162	0.182	0.173	Q9VJP9.pdb.gz	Q9VJP9_DROME GEO12025p1 OS=Drosophila melanogaster OX=7227 GN=Uxt PE=1 SV=3
7	AFDB:O58263	0.799	0.828	1.614E-8	148	0.208	0.216	O58263.pdb.gz	PFDA_PYRHO Prefoldin subunit alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=pfdA PE=1 SV=2
8	PDB:2zdiC	0.754	0.781	7.501E-8	148	0.214	0.223	2zdiC.pdb.gz
9	AFDB:Q66IA7	0.752	0.747	4.492E-7	155	0.175	0.174	Q66IA7.pdb.gz	Q66IA7_DANRE Protein UXT OS=Danio rerio OX=7955 GN=zgc:101894 PE=1 SV=1
10	AFDB:Q9UBK9	0.751	0.737	6.545E-7	157	0.136	0.134	Q9UBK9.pdb.gz	UXT_HUMAN Protein UXT OS=Homo sapiens OX=9606 GN=UXT PE=1 SV=1
11	AFDB:Q10143	0.601	0.559	1.786E-6	169	0.162	0.148	Q10143.pdb.gz	PFD3_SCHPO Probable prefoldin subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H8.07c PE=3 SV=1
12	PDB:2zdiB	0.549	0.774	5.326E-3	106	0.130	0.189	2zdiB.pdb.gz
13	PDB:8cxm0	0.260	0.162	1.153E-1	267	0.156	0.090	8cxm0.pdb.gz
14	PDB:6vq6H	0.306	0.237	6.683E-1	214	0.136	0.098	6vq6H.pdb.gz	Structure of V-ATPase from the mammalian brain.
15	PDB:6o7va	0.270	0.096	8.068E-1	625	0.169	0.042	6o7va.pdb.gz
16	PDB:7l08AF	0.181	0.145	9.739E-1	208	0.117	0.087	7l08AF.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
17	PDB:3ajwA	0.355	0.405	1.037	134	0.149	0.172	3ajwA.pdb.gz
18	PDB:7w6xA	0.126	0.054	1.037	447	0.071	0.025	7w6xA.pdb.gz	Mechanistic insights into intramembrane proteolysis by E. coli site-2 protease homolog RseP.
19	PDB:7f3fA	0.288	0.125	1.333	460	0.123	0.041	7f3fA.pdb.gz
20	PDB:5d80G	0.306	0.231	1.511	223	0.110	0.076	5d80G.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99471	6.65e-111	313	154	1.000	1.000	PFD5_HUMAN Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2
2	Q9WU28	3.41e-110	311	154	0.994	0.994	PFD5_MOUSE Prefoldin subunit 5 OS=Mus musculus OX=10090 GN=Pfdn5 PE=1 SV=1
3	B5DFN4	1.69e-109	309	154	0.987	0.987	B5DFN4_RAT Prefoldin 5 (Predicted), isoform CRA_a OS=Rattus norvegicus OX=10116 GN=Pfdn5 PE=2 SV=1
4	Q8HYI9	2.58e-108	306	154	0.974	0.974	PFD5_BOVIN Prefoldin subunit 5 OS=Bos taurus OX=9913 GN=PFDN5 PE=2 SV=1
5	H3BPF6	7.76e-101	288	156	0.955	0.942	H3BPF6_HUMAN Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2
6	O94307	7.56e-35	120	154	0.403	0.403	PFD5_SCHPO Probable prefoldin subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bob1 PE=1 SV=1
7	Q9VCZ8	3.43e-32	114	168	0.338	0.310	PFD5_DROME Probable prefoldin subunit 5 OS=Drosophila melanogaster OX=7227 GN=Pfdn5 PE=1 SV=1
8	Q04493	1.35e-29	107	163	0.331	0.313	PFD5_YEAST Prefoldin subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIM5 PE=1 SV=1
9	P57742	4.73e-27	100	151	0.344	0.351	PFD5_ARATH Prefoldin subunit 5 OS=Arabidopsis thaliana OX=3702 GN=PFD5 PE=1 SV=1
10	O58263	2.58e-07	49.3	148	0.195	0.203	PFDA_PYRHO Prefoldin subunit alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=pfdA PE=1 SV=2
11	Q9VJP9	7.01e-04	40.0	162	0.208	0.198	Q9VJP9_DROME GEO12025p1 OS=Drosophila melanogaster OX=7227 GN=Uxt PE=1 SV=3
12	Q66IA7	0.022	35.8	155	0.188	0.187	Q66IA7_DANRE Protein UXT OS=Danio rerio OX=7955 GN=zgc:101894 PE=1 SV=1
13	P27680	0.94	31.6	312	0.110	0.054	COQ3_YEAST Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ3 PE=1 SV=2
14	P25269	1.2	31.6	475	0.130	0.042	TRBP2_ARATH Tryptophan synthase beta chain 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TSB2 PE=1 SV=2
15	O94763	1.8	30.8	535	0.169	0.049	RMP_HUMAN Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1 PE=1 SV=3
16	Q5AFP8	1.9	30.8	702	0.110	0.024	KEX1_CANAL Pheromone-processing carboxypeptidase KEX1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KEX1 PE=3 SV=1
17	O94521	2.9	30.0	333	0.123	0.057	PLR2_SCHPO Probable pyridoxal reductase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1281.04 PE=3 SV=1
18	Q9D9D3	4.9	29.6	336	0.110	0.051	TBC21_MOUSE TBC1 domain family member 21 OS=Mus musculus OX=10090 GN=Tbc1d21 PE=1 SV=1
19	Q9H6P5	4.9	29.6	420	0.110	0.040	TASP1_HUMAN Threonine aspartase 1 OS=Homo sapiens OX=9606 GN=TASP1 PE=1 SV=1
20	P18459	5.8	29.3	579	0.071	0.019	TY3H_DROME Tyrosine 3-monooxygenase OS=Drosophila melanogaster OX=7227 GN=ple PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16088 BORCS7	2.6e+02	13.3	BLOC-1-related complex sub-unit 7
2	PF08786 DcrB	5.9e+02	12.0	DcrB
3	PF10704 DUF2508	5e+02	12.3	Protein of unknown function (DUF2508)
4	PF12998 ING	2.3e+02	13.8	Inhibitor of growth proteins N-terminal histone-binding
5	PF02996 Prefoldin	2.1e-25	100.3	Prefoldin subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006169123.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006144295.1	0.999	Prefoldin subunit 6
2	246437.XP_006156259.1	0.999	Prefoldin subunit 1
3	246437.XP_006171135.1	0.999	Prefoldin subunit 3
4	246437.XP_006163168.1	0.998	Prefoldin subunit 2
5	246437.XP_006141958.1	0.995	Prefoldin subunit 4 isoform X1
6	246437.XP_006145626.1	0.995	Prefoldin subunit 4-like
7	246437.XP_006156749.1	0.970	Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes.
8	246437.XP_006142912.1	0.957	Bardet-Biedl syndrome 10 protein homolog isoform X1
9	246437.XP_006163322.1	0.920	annotation not available
10	246437.XP_006152304.1	0.890	annotation not available
11	246437.XP_006165854.1	0.869	Protein UXT
12	246437.XP_006168053.1	0.858	Programmed cell death protein 5
13	246437.XP_006146231.1	0.848	annotation not available
14	246437.XP_006170839.1	0.822	Ribosomal RNA small subunit methyltransferase NEP1
15	246437.XP_006171689.1	0.822	Transmembrane protein 147 isoform X1
16	246437.XP_006143373.1	0.819	Chaperonin containing TCP1 subunit 5
17	246437.XP_006151319.1	0.816	Molecular chaperone
18	246437.XP_006157581.1	0.812	39S ribosomal protein L13, mitochondrial
19	246437.XP_006160873.1	0.809	Mitochondrial import inner membrane translocase subunit Tim10
20	246437.XP_006155246.1	0.808	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0065007	0.977	biological regulation
GO:0050789	0.971	regulation of biological process
GO:0050794	0.961	regulation of cellular process
GO:0019222	0.918	regulation of metabolic process
GO:0051171	0.858	regulation of nitrogen compound metabolic process
GO:0080090	0.829	regulation of primary metabolic process
GO:0048519	0.815	negative regulation of biological process
GO:0032502	0.773	developmental process
GO:0048856	0.763	anatomical structure development
GO:0060255	0.763	regulation of macromolecule metabolic process
GO:0031323	0.745	regulation of cellular metabolic process
GO:0006457	0.712	protein folding
GO:0007275	0.707	multicellular organism development
GO:0060041	0.684	retina development in camera-type eye
GO:0030111	0.675	regulation of Wnt signaling pathway
GO:0048523	0.634	negative regulation of cellular process
GO:0010468	0.584	regulation of gene expression
GO:0009892	0.484	negative regulation of metabolic process
GO:0019219	0.465	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.456	regulation of macromolecule biosynthetic process
GO:0031326	0.455	regulation of cellular biosynthetic process
GO:0051172	0.435	negative regulation of nitrogen compound metabolic process
GO:0071704	0.375	organic substance metabolic process
GO:1902903	0.315	regulation of supramolecular fiber organization
GO:0051252	0.303	regulation of RNA metabolic process
GO:0010605	0.301	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.997	protein-containing complex
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005634	0.992	nucleus
GO:0043232	0.973	intracellular non-membrane-bounded organelle
GO:0070013	0.803	intracellular organelle lumen
GO:0031981	0.793	nuclear lumen
GO:0005654	0.608	nucleoplasm
GO:0005856	0.574	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]