StarFunc result for job id Q99490

User Input

>input (1192 residues)
MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAVGAPGARGSEPRDPGSPRGAEE
PGKKRHERLFHRQDALWISTSSAGAGGAEPPALSPAPASPARPVSPAPGRRLSLWAAPPG
PPLSGGLSPDSKPGGAPSSSRRPLLSSPSWGGPEPEGRTGGGVPGSSSPHPGTGSRRLKV
APPPPAPKPCKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSSAGTGASVSAAATA
AAAGGGGSTASTSGGVGAGAGARGKLSPRKGKSKTLDNSDLHPGPPAGSPPPLTLPPTPS
PATAVTAASAQPPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPP
GSGPLPGPPSLSSGSGSRELLGAELRASPKAVINSQEWTLSRSIPELRLGVLGDARSGKS
SLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFS
LEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMK
RCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQAS
NGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEK
RSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHS
THGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGLEATTPMPSPSP
SPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTT
PSKTEGSAGQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDA
WVQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLN
LGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRAK
PSRDSSREERESWIRAKYEQLLFLAPLSTSEEPLGRQLWAAVQAQDVATVLLLLAHARHG
PLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGSQLCA
DILLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRADAPVALV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3lvqE	0.167	0.453	2.116E-14	420	0.063	0.179	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
2	PDB:2f9mA	0.137	0.822	7.157E-11	182	0.034	0.220	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
3	PDB:7sd0B	0.131	0.820	8.402E-11	174	0.034	0.236	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
4	PDB:6zqtA	0.135	0.867	1.222E-10	173	0.034	0.237	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
5	PDB:1vg8A	0.137	0.812	1.359E-10	184	0.032	0.207	1vg8A.pdb.gz	Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease
6	PDB:2bovA	0.132	0.844	1.684E-10	173	0.035	0.243	2bovA.pdb.gz	Molecular Recognition of an Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme by Rala Gtpase
7	PDB:7e1tB	0.129	0.815	2.085E-10	174	0.039	0.264	7e1tB.pdb.gz	Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.
8	PDB:6kykC	0.129	0.850	2.320E-10	169	0.032	0.225	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
9	PDB:6zizA	0.133	0.874	2.448E-10	170	0.031	0.218	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
10	PDB:5szjA	0.129	0.805	2.582E-10	175	0.025	0.171	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
11	AFDB:A0A0B4LFV4	0.134	0.211	7.306E-9	742	0.095	0.152	A0A0B4LFV4.pdb.gz	A0A0B4LFV4_DROME Rad, Gem/Kir family member 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Rgk2 PE=4 SV=1
12	AFDB:A1ZBJ6	0.127	0.111	1.443E-4	1379	0.092	0.080	A1ZBJ6.pdb.gz	A1ZBJ6_DROME Rad, Gem/Kir family member 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Rgk1 PE=4 SV=2
13	AFDB:P34288	0.051	0.040	1.443E-4	1605	0.106	0.079	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
14	AFDB:Q9SLF3	0.116	0.114	6.446E-4	1206	0.076	0.075	Q9SLF3.pdb.gz	TC132_ARATH Translocase of chloroplast 132, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC132 PE=1 SV=1
15	AFDB:Q9LUS2	0.113	0.122	7.174E-4	1089	0.070	0.076	Q9LUS2.pdb.gz	TC120_ARATH Translocase of chloroplast 120, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC120 PE=1 SV=1
16	AFDB:A2ABF9	0.083	0.078	9.887E-4	1267	0.144	0.136	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
17	AFDB:Q9SQV1	0.041	0.043	1.292E-3	1088	0.107	0.117	Q9SQV1.pdb.gz	RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana OX=3702 GN=RH40 PE=2 SV=1
18	AFDB:Q9H9B1	0.089	0.082	1.363E-3	1298	0.123	0.113	Q9H9B1.pdb.gz	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
19	AFDB:A0A0G2K889	0.089	0.083	3.567E-3	1289	0.124	0.115	A0A0G2K889.pdb.gz	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2
20	AFDB:Q10728	0.046	0.052	4.916E-3	1032	0.105	0.121	Q10728.pdb.gz	MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus OX=10116 GN=Ppp1r12a PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JMI1	0.0	754	827	0.370	0.533	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1
2	F8VVT9	0.0	2353	1192	0.992	0.992	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
3	J3KNM6	0.0	2051	1036	0.866	0.996	J3KNM6_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
4	Q3UHD9	0.0	1982	1186	0.950	0.954	AGAP2_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Agap2 PE=1 SV=1
5	Q8CGU4	0.0	1967	1186	0.954	0.959	AGAP2_RAT Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Agap2 PE=1 SV=1
6	Q8VHH5	0.0	772	910	0.358	0.469	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
7	Q99490	0.0	2372	1192	1.000	1.000	AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=2
8	Q9UPQ3	0.0	830	857	0.377	0.524	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
9	U6A022	4.79e-138	441	808	0.187	0.276	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
10	Q9NGC3	3.04e-103	352	995	0.179	0.214	CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster OX=7227 GN=CenG1A PE=2 SV=2
11	Q9XX14	2.73e-62	234	1107	0.118	0.127	CNT2_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 OS=Caenorhabditis elegans OX=6239 GN=cnt-2 PE=1 SV=2
12	Q54WI0	3.81e-38	158	1333	0.091	0.081	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
13	Q4QQN0	3.46e-34	142	626	0.072	0.137	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
14	A2ADA6	9.31e-34	142	829	0.072	0.104	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
15	Q6NXL5	9.52e-34	142	833	0.067	0.096	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
16	Q3UH98	1.04e-33	142	833	0.067	0.096	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
17	Q5W7F2	8.65e-32	136	827	0.081	0.117	AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana OX=3702 GN=AGD3 PE=1 SV=1
18	Q551Q8	7.24e-30	130	843	0.061	0.087	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1
19	A0A0R4IPR8	1.01e-29	129	761	0.065	0.102	A0A0R4IPR8_DANRE ARF GTPase-activating protein GIT1 isoform X1 OS=Danio rerio OX=7955 GN=git1 PE=1 SV=1
20	E7FAZ2	1.27e-29	129	752	0.065	0.104	E7FAZ2_DANRE ARF GTPase-activating protein GIT1 isoform X2 OS=Danio rerio OX=7955 GN=git1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.0081	27.7	Ankyrin repeat
2	PF12796 Ank_2	0.0011	30.8	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	5.1e+02	12.7	Ankyrin repeat
4	PF13637 Ank_4	1.6	20.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.24	23.0	Ankyrin repeats (many copies)
6	PF01412 ArfGap	2.7e-35	132.4	Putative GTPase activating protein for Arf
7	PF18697 MLVIN_C	1.2e+02	14.2	Murine leukemia virus (MLV) integrase (IN) C-terminal domain
8	PF00169 PH	8.7e-06	37.6	PH domain
9	PF15413 PH_11	2.9e+02	13.4	Pleckstrin homology domain
10	PF15406 PH_6	13	17.5	Pleckstrin homology domain
11	PF00071 Ras	3.9e-12	57.6	Ras family
12	PF08477 Roc	31	16.2	Ras of Complex, Roc, domain of DAPkinase
13	PF09547 SpoIVA_ATPase	97	13.7	Stage IV sporulation protein A, ATPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000449241

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337168	0.980	Band 4.1-like protein 1
2	9606.ENSP00000334329	0.941	Netrin receptor UNC5B
3	9606.ENSP00000428056	0.936	Phosphatidylinositol 3-kinase regulatory subunit alpha
4	9606.ENSP00000346671	0.924	Tyrosine-protein kinase Fyn
5	9606.ENSP00000263967	0.916	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
6	9606.ENSP00000358525	0.911	Beta-nerve growth factor
7	9606.ENSP00000173229	0.909	Netrin-1
8	9606.ENSP00000431418	0.907	High affinity nerve growth factor receptor
9	9606.ENSP00000354896	0.888	Metabotropic glutamate receptor 1
10	9606.ENSP00000478767	0.768	Neurabin-2
11	9606.ENSP00000341562	0.746	Beta-1,4 N-acetylgalactosaminyltransferase 1
12	9606.ENSP00000376911	0.745	Legumain
13	9606.ENSP00000300145	0.720	Mitochondrial inner membrane protease ATP23 homolog
14	9606.ENSP00000316377	0.713	Disks large-associated protein 1
15	9606.ENSP00000257910	0.712	Tetraspanin-31
16	9606.ENSP00000314441	0.708	tRNA (guanine-N(7)-)-methyltransferase
17	9606.ENSP00000368017	0.700	Zinc finger C3H1 domain-containing protein
18	9606.ENSP00000403397	0.681	Palmitoyltransferase ZDHHC17
19	9606.ENSP00000299300	0.671	T-complex protein 1 subunit beta
20	9606.ENSP00000332413	0.668	Bestrophin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003824	0.963	catalytic activity
GO:0003924	0.891	GTPase activity
GO:0043168	0.806	anion binding
GO:0036094	0.766	small molecule binding
GO:0035639	0.761	purine ribonucleoside triphosphate binding
GO:0032555	0.757	purine ribonucleotide binding
GO:0019899	0.751	enzyme binding
GO:0098772	0.560	molecular function regulator activity
GO:0030234	0.526	enzyme regulator activity
GO:0008047	0.461	enzyme activator activity
GO:0019900	0.345	kinase binding
GO:0019901	0.341	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.989	positive regulation of biological process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0050896	0.957	response to stimulus
GO:0048522	0.918	positive regulation of cellular process
GO:0051716	0.865	cellular response to stimulus
GO:0019222	0.861	regulation of metabolic process
GO:0048519	0.776	negative regulation of biological process
GO:0080090	0.768	regulation of primary metabolic process
GO:0048523	0.744	negative regulation of cellular process
GO:0031323	0.741	regulation of cellular metabolic process
GO:0007154	0.720	cell communication
GO:0060255	0.678	regulation of macromolecule metabolic process
GO:0051171	0.675	regulation of nitrogen compound metabolic process
GO:0048583	0.620	regulation of response to stimulus
GO:0043066	0.618	negative regulation of apoptotic process
GO:0023052	0.607	signaling
GO:0009893	0.514	positive regulation of metabolic process
GO:0044093	0.507	positive regulation of molecular function
GO:0009966	0.504	regulation of signal transduction
GO:0007165	0.482	signal transduction
GO:0048584	0.474	positive regulation of response to stimulus
GO:0031325	0.452	positive regulation of cellular metabolic process
GO:0010604	0.434	positive regulation of macromolecule metabolic process
GO:0051173	0.422	positive regulation of nitrogen compound metabolic process
GO:0032501	0.399	multicellular organismal process
GO:0043085	0.398	positive regulation of catalytic activity
GO:0071840	0.389	cellular component organization or biogenesis
GO:0009967	0.384	positive regulation of signal transduction
GO:0048856	0.376	anatomical structure development
GO:0042327	0.369	positive regulation of phosphorylation
GO:0016043	0.350	cellular component organization
GO:1901214	0.334	regulation of neuron death
GO:0043550	0.327	regulation of lipid kinase activity
GO:1901215	0.317	negative regulation of neuron death
GO:0010468	0.308	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.998	nucleoplasm
GO:0016020	0.983	membrane
GO:0030496	0.955	midbody
GO:0090543	0.948	Flemming body
GO:0005886	0.920	plasma membrane
GO:0031982	0.777	vesicle
GO:0012505	0.756	endomembrane system
GO:0005576	0.616	extracellular region
GO:0005615	0.456	extracellular space
GO:0043005	0.405	neuron projection
GO:0043232	0.378	intracellular non-membrane-bounded organelle
GO:0045202	0.356	synapse
GO:0097708	0.336	intracellular vesicle
GO:0031410	0.307	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.891	GTP + H2O = GDP + H(+) + phosphate

[back to server]