StarFunc result for job id Q99496

User Input

>input (336 residues)
MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKN
TMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEY
EAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCS
NASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKD
DSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASG
QFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99496	1.000	1.000	2.741E-65	336	1.000	1.000	Q99496.pdb.gz	RING2_HUMAN E3 ubiquitin-protein ligase RING2 OS=Homo sapiens OX=9606 GN=RNF2 PE=1 SV=1
2	AFDB:Q803I4	0.874	0.874	4.050E-58	336	0.893	0.893	Q803I4.pdb.gz	RING2_DANRE E3 ubiquitin-protein ligase RING2 OS=Danio rerio OX=7955 GN=rnf2 PE=2 SV=1
3	AFDB:A0A1U9X8F2	0.421	0.353	5.144E-40	406	0.643	0.532	A0A1U9X8F2.pdb.gz	A0A1U9X8F2_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=1
4	AFDB:Q9VB08	0.430	0.335	1.105E-31	435	0.560	0.432	Q9VB08.pdb.gz	RING1_DROME E3 ubiquitin-protein ligase RING1 OS=Drosophila melanogaster OX=7227 GN=Sce PE=1 SV=1
5	PDB:4r8pL	0.295	0.387	9.596E-17	254	0.301	0.398	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
6	AFDB:F4I2H4	0.290	0.213	3.710E-15	468	0.247	0.177	F4I2H4.pdb.gz	F4I2H4_ARATH RING 1B OS=Arabidopsis thaliana OX=3702 GN=RING1B PE=1 SV=1
7	AFDB:Q19336	0.226	0.147	5.268E-11	549	0.155	0.095	Q19336.pdb.gz	PCGF3_CAEEL Polycomb group RING finger protein 3 homolog mig-32 OS=Caenorhabditis elegans OX=6239 GN=mig-32 PE=2 SV=4
8	AFDB:P35820	0.237	0.067	4.282E-9	1601	0.152	0.032	P35820.pdb.gz	PSC_DROME Polycomb group protein Psc OS=Drosophila melanogaster OX=7227 GN=Psc PE=1 SV=2
9	AFDB:F4K8U4	0.243	0.161	1.105E-7	525	0.217	0.139	F4K8U4.pdb.gz	F4K8U4_ARATH RING 1A OS=Arabidopsis thaliana OX=3702 GN=RING1A PE=1 SV=1
10	AFDB:H2KYH3	0.232	0.036	4.787E-7	2476	0.182	0.025	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
11	AFDB:Q21610	0.209	0.115	6.532E-6	627	0.110	0.059	Q21610.pdb.gz	Q21610_CAEEL Par-2 protein OS=Caenorhabditis elegans OX=6239 GN=par-2 PE=2 SV=1
12	PDB:5k1aF	0.198	0.122	2.598E-5	600	0.062	0.035	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
13	PDB:4rm8A	0.195	0.180	1.056E-4	368	0.033	0.030	4rm8A.pdb.gz
14	PDB:3plvA	0.198	0.708	3.120E-4	80	0.051	0.212	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
15	PDB:7lq1A	0.198	0.077	4.291E-4	950	0.033	0.012	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
16	PDB:5gm6a	0.176	0.443	5.537E-4	123	0.057	0.154	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:7jzvA	0.197	0.258	8.117E-4	253	0.074	0.099	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
18	PDB:5dkaA	0.176	0.590	1.190E-3	96	0.060	0.208	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
19	PDB:5dxhD	0.223	0.087	1.268E-3	981	0.042	0.014	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
20	PDB:2y3aA	0.203	0.079	1.535E-3	976	0.033	0.011	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4KLY4	0.0	634	308	0.902	0.984	RING2_RAT E3 ubiquitin-protein ligase RING2 OS=Rattus norvegicus OX=10116 GN=Rnf2 PE=2 SV=1
2	Q803I4	0.0	633	336	0.893	0.893	RING2_DANRE E3 ubiquitin-protein ligase RING2 OS=Danio rerio OX=7955 GN=rnf2 PE=2 SV=1
3	Q99496	0.0	704	336	1.000	1.000	RING2_HUMAN E3 ubiquitin-protein ligase RING2 OS=Homo sapiens OX=9606 GN=RNF2 PE=1 SV=1
4	Q9CQJ4	0.0	702	336	0.997	0.997	RING2_MOUSE E3 ubiquitin-protein ligase RING2 OS=Mus musculus OX=10090 GN=Rnf2 PE=1 SV=1
5	X6RFN3	0.0	516	245	0.729	1.000	X6RFN3_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=RNF2 PE=1 SV=2
6	O35730	1.73e-133	387	406	0.622	0.515	RING1_MOUSE E3 ubiquitin-protein ligase RING1 OS=Mus musculus OX=10090 GN=Ring1 PE=1 SV=2
7	A0A1U9X8F2	5.15e-133	386	406	0.631	0.522	A0A1U9X8F2_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=1
8	Q06587	5.15e-133	386	406	0.631	0.522	RING1_HUMAN E3 ubiquitin-protein ligase RING1 OS=Homo sapiens OX=9606 GN=RING1 PE=1 SV=2
9	Q9VB08	1.26e-79	251	435	0.345	0.267	RING1_DROME E3 ubiquitin-protein ligase RING1 OS=Drosophila melanogaster OX=7227 GN=Sce PE=1 SV=1
10	Q0WX00	1.64e-23	102	460	0.125	0.091	RNG1B_ARATH Putative E3 ubiquitin-protein ligase RING1b OS=Arabidopsis thaliana OX=3702 GN=RING1B PE=1 SV=1
11	F4I2H4	1.67e-23	102	468	0.125	0.090	F4I2H4_ARATH RING 1B OS=Arabidopsis thaliana OX=3702 GN=RING1B PE=1 SV=1
12	Q9FKW0	2.95e-23	102	522	0.146	0.094	RNG1A_ARATH Putative E3 ubiquitin-protein ligase RING1a OS=Arabidopsis thaliana OX=3702 GN=RING1A PE=1 SV=2
13	H2KYH3	3.07e-15	79.3	2476	0.101	0.014	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
14	F4K8U4	1.21e-08	58.5	525	0.122	0.078	F4K8U4_ARATH RING 1A OS=Arabidopsis thaliana OX=3702 GN=RING1A PE=1 SV=1
15	O54952	2.09e-08	58.2	1817	0.143	0.026	BRCA1_RAT Breast cancer type 1 susceptibility protein homolog OS=Rattus norvegicus OX=10116 GN=Brca1 PE=1 SV=1
16	Q8BTQ0	3.32e-08	55.8	241	0.188	0.261	PCGF3_MOUSE Polycomb group RING finger protein 3 OS=Mus musculus OX=10090 GN=PcgF3 PE=1 SV=1
17	Q90Z51	2.00e-07	55.1	1749	0.083	0.016	Q90Z51_CHICK RING-type E3 ubiquitin transferase OS=Gallus gallus OX=9031 GN=BRCA1 PE=2 SV=1
18	Q9M9Y4	4.59e-07	53.5	421	0.089	0.071	DRIP1_ARATH E3 ubiquitin protein ligase DRIP1 OS=Arabidopsis thaliana OX=3702 GN=DRIP1 PE=1 SV=2
19	P43254	5.31e-07	53.5	675	0.080	0.040	COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana OX=3702 GN=COP1 PE=1 SV=2
20	P38398	5.67e-07	53.9	1863	0.074	0.013	BRCA1_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16207 RAWUL	1.6e-25	100.8	RAWUL domain RING finger- and WD40-associated ubiquitin-like
2	PF12861 zf-ANAPC11	7.3e+02	11.6	Anaphase-promoting complex subunit 11 RING-H2 finger
3	PF00097 zf-C3HC4	1.9e-06	38.9	Zinc finger, C3HC4 type (RING finger)
4	PF13923 zf-C3HC4_2	4.9e-13	60.0	Zinc finger, C3HC4 type (RING finger)
5	PF13920 zf-C3HC4_3	0.00044	31.3	Zinc finger, C3HC4 type (RING finger)
6	PF15227 zf-C3HC4_4	0.24	22.8	zinc finger of C3HC4-type, RING
7	PF17121 zf-C3HC4_5	1.7e+02	13.5	Zinc finger, C3HC4 type (RING finger)
8	PF11789 zf-Nse	1.1	20.6	Zinc-finger of the MIZ type in Nse subunit
9	PF12678 zf-rbx1	6.2	18.5	RING-H2 zinc finger domain
10	PF13639 zf-RING_2	2.1e-05	36.1	Ring finger domain
11	PF14570 zf-RING_4	1.3	20.2	RING/Ubox like zinc-binding domain
12	PF14634 zf-RING_5	0.075	24.3	zinc-RING finger domain
13	PF14835 zf-RING_6	3.6	18.9	zf-RING of BARD1-type protein
14	PF13445 zf-RING_UBOX	0.04	25.3	RING-type zinc-finger
15	PF14569 zf-UDP	1.4e+02	14.0	Zinc-binding RING-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005540284.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005548511.1	0.999	Serine/arginine repetitive matrix protein 2-like
2	9541.XP_005570107.1	0.999	Polyhomeotic-like protein 1
3	9541.XP_005564840.1	0.998	Polycomb group RING finger protein 4
4	9541.XP_005544108.1	0.990	Polyhomeotic-like protein 2 isoform X1
5	9541.XP_005567302.1	0.987	Chromobox protein homolog 7
6	9541.XP_005566396.1	0.984	Polycomb group RING finger protein 6 isoform X1
7	9541.XP_005565990.1	0.983	Polycomb group RING finger protein 5 isoform X1
8	9541.XP_005584037.1	0.981	DNA-binding protein Mel-18
9	9541.XP_005575569.1	0.980	Polycomb group RING finger protein 1
10	9541.XP_005585232.1	0.980	Uncharacterized protein
11	9541.XP_005576599.1	0.978	Uncharacterized protein
12	9541.XP_005570651.1	0.977	YY1-associated factor 2 isoform X1
13	9541.XP_005585461.1	0.971	E3 SUMO-protein ligase CBX4
14	9541.XP_005585235.1	0.970	Uncharacterized protein
15	9541.XP_005572502.1	0.965	Uncharacterized protein
16	9541.XP_005555623.1	0.960	Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-, as well as 'Lys-48'-linked polyubiquitination. Cooperates with the E2 CDC34 and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Ubiquitin chain elongation is then performed by CDC34, building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. Acts also [...]
17	9541.XP_005591751.1	0.960	F-box and leucine-rich repeat protein 19
18	9541.XP_005593355.1	0.959	BCL-6 corepressor-like isoform X1
19	9541.XP_005542099.1	0.957	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
20	9541.XP_005553387.1	0.957	E3 ubiquitin-protein ligase RING1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0008270	0.915	zinc ion binding
GO:0019904	0.911	protein domain specific binding
GO:0071535	0.544	RING-like zinc finger domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0050794	0.994	regulation of cellular process
GO:0019222	0.992	regulation of metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:0009987	0.981	cellular process
GO:0036211	0.981	protein modification process
GO:0080090	0.974	regulation of primary metabolic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0051171	0.974	regulation of nitrogen compound metabolic process
GO:0031323	0.974	regulation of cellular metabolic process
GO:0070647	0.972	protein modification by small protein conjugation or removal
GO:0048519	0.958	negative regulation of biological process
GO:0016570	0.944	histone modification
GO:0010468	0.932	regulation of gene expression
GO:0019219	0.918	regulation of nucleobase-containing compound metabolic process
GO:0016567	0.905	protein ubiquitination
GO:0009889	0.889	regulation of biosynthetic process
GO:0006355	0.875	regulation of DNA-templated transcription
GO:0032502	0.868	developmental process
GO:0048523	0.748	negative regulation of cellular process
GO:0006513	0.580	protein monoubiquitination
GO:0032501	0.548	multicellular organismal process
GO:0071840	0.526	cellular component organization or biogenesis
GO:0016043	0.483	cellular component organization
GO:0009892	0.470	negative regulation of metabolic process
GO:0010605	0.461	negative regulation of macromolecule metabolic process
GO:0006325	0.452	chromatin organization
GO:0048856	0.430	anatomical structure development
GO:0051172	0.420	negative regulation of nitrogen compound metabolic process
GO:0050896	0.418	response to stimulus
GO:0031324	0.415	negative regulation of cellular metabolic process
GO:0045934	0.414	negative regulation of nucleobase-containing compound metabolic process
GO:0006357	0.394	regulation of transcription by RNA polymerase II
GO:0007275	0.392	multicellular organism development
GO:0016574	0.387	histone ubiquitination
GO:0009890	0.384	negative regulation of biosynthetic process
GO:0048518	0.374	positive regulation of biological process
GO:0006338	0.374	chromatin remodeling
GO:0031327	0.368	negative regulation of cellular biosynthetic process
GO:0010558	0.365	negative regulation of macromolecule biosynthetic process
GO:0051253	0.362	negative regulation of RNA metabolic process
GO:0048522	0.357	positive regulation of cellular process
GO:1903507	0.305	negative regulation of nucleic acid-templated transcription
GO:0045892	0.304	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990234	1.000	transferase complex
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0140535	0.998	intracellular protein-containing complex
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0000151	0.989	ubiquitin ligase complex
GO:0016604	0.983	nuclear body
GO:0031519	0.972	PcG protein complex
GO:0000785	0.942	chromatin
GO:0005737	0.919	cytoplasm
GO:0000152	0.639	nuclear ubiquitin ligase complex
GO:0035102	0.565	PRC1 complex
GO:0034708	0.499	methyltransferase complex
GO:0035097	0.484	histone methyltransferase complex
GO:0044665	0.461	MLL1/2 complex
GO:0071339	0.445	MLL1 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]