StarFunc result for job id Q99500

User Input

>input (378 residues)
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99500	1.000	1.000	1.497E-48	378	1.000	1.000	Q99500.pdb.gz	S1PR3_HUMAN Sphingosine 1-phosphate receptor 3 OS=Homo sapiens OX=9606 GN=S1PR3 PE=1 SV=2
2	AFDB:Q9Z0U9	0.882	0.882	4.018E-43	378	0.876	0.876	Q9Z0U9.pdb.gz	S1PR3_MOUSE Sphingosine 1-phosphate receptor 3 OS=Mus musculus OX=10090 GN=S1pr3 PE=2 SV=1
3	AFDB:P48303	0.785	0.774	2.768E-30	383	0.497	0.491	P48303.pdb.gz	S1PR1_RAT Sphingosine 1-phosphate receptor 1 OS=Rattus norvegicus OX=10116 GN=S1pr1 PE=1 SV=1
4	PDB:7ew2R	0.701	0.902	2.958E-30	290	0.762	0.993	7ew2R.pdb.gz	Structural insights into sphingosine-1-phosphate recognition and ligand selectivity of S1PR3-Gi signaling complexes.
5	AFDB:Q9DDK4	0.771	0.805	3.372E-29	362	0.492	0.514	Q9DDK4.pdb.gz	S1PR1_DANRE Sphingosine 1-phosphate receptor 1 OS=Danio rerio OX=7955 GN=s1pr1 PE=2 SV=2
6	PDB:7td3R	0.709	0.909	4.587E-26	292	0.458	0.592	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
7	AFDB:O95136	0.756	0.809	2.956E-25	353	0.426	0.456	O95136.pdb.gz	S1PR2_HUMAN Sphingosine 1-phosphate receptor 2 OS=Homo sapiens OX=9606 GN=S1PR2 PE=1 SV=2
8	AFDB:Q9H228	0.776	0.738	3.681E-25	398	0.418	0.397	Q9H228.pdb.gz	S1PR5_HUMAN Sphingosine 1-phosphate receptor 5 OS=Homo sapiens OX=9606 GN=S1PR5 PE=1 SV=1
9	AFDB:Q91X56	0.771	0.729	6.511E-25	400	0.418	0.395	Q91X56.pdb.gz	S1PR5_MOUSE Sphingosine 1-phosphate receptor 5 OS=Mus musculus OX=10090 GN=S1pr5 PE=1 SV=1
10	AFDB:Q9I8K8	0.760	0.776	1.565E-24	370	0.426	0.435	Q9I8K8.pdb.gz	S1PR2_DANRE Sphingosine 1-phosphate receptor 2 OS=Danio rerio OX=7955 GN=s1pr2 PE=1 SV=1
11	AFDB:Q6NYH8	0.747	0.638	5.708E-23	445	0.423	0.360	Q6NYH8.pdb.gz
12	PDB:3v2yA	0.706	0.590	5.467E-22	455	0.452	0.376	3v2yA.pdb.gz	Crystal structure of a lipid G protein-coupled receptor.
13	AFDB:P61793	0.752	0.780	9.876E-22	364	0.339	0.352	P61793.pdb.gz	LPAR1_MOUSE Lysophosphatidic acid receptor 1 OS=Mus musculus OX=10090 GN=Lpar1 PE=1 SV=1
14	PDB:7t6bR	0.631	0.887	2.959E-18	264	0.360	0.515	7t6bR.pdb.gz	Structure of S1PR2-heterotrimeric G 13 signaling complex.
15	PDB:7yu4A	0.644	0.904	1.010E-17	266	0.291	0.414	7yu4A.pdb.gz	Structure of the active G i -coupled human lysophosphatidic acid receptor 1 complexed with a potent agonist.
16	PDB:7td1R	0.687	0.876	6.375E-17	293	0.299	0.386	7td1R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
17	PDB:7wv9R	0.599	0.763	8.479E-12	290	0.228	0.297	7wv9R.pdb.gz	Molecular mechanism of allosteric modulation for the cannabinoid receptor CB1.
18	PDB:6pt0R	0.630	0.787	1.010E-11	298	0.204	0.258	6pt0R.pdb.gz	Cryo-EM Structure of the Human Cannabinoid Receptor CB2-GiSignaling Complex.
19	PDB:7f53R	0.576	0.777	1.033E-10	273	0.190	0.264	7f53R.pdb.gz	Structural insights into ligand recognition and activation of the melanocortin-4 receptor.
20	PDB:7e32R	0.549	0.714	6.237E-10	285	0.196	0.260	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99500	0.0	772	378	1.000	1.000	S1PR3_HUMAN Sphingosine 1-phosphate receptor 3 OS=Homo sapiens OX=9606 GN=S1PR3 PE=1 SV=2
2	Q9Z0U9	0.0	632	378	0.876	0.876	S1PR3_MOUSE Sphingosine 1-phosphate receptor 3 OS=Mus musculus OX=10090 GN=S1pr3 PE=2 SV=1
3	O08530	5.80e-135	392	382	0.534	0.529	S1PR1_MOUSE Sphingosine 1-phosphate receptor 1 OS=Mus musculus OX=10090 GN=S1pr1 PE=1 SV=3
4	P48303	5.20e-134	390	383	0.521	0.514	S1PR1_RAT Sphingosine 1-phosphate receptor 1 OS=Rattus norvegicus OX=10116 GN=S1pr1 PE=1 SV=1
5	P21453	1.37e-132	386	382	0.521	0.516	S1PR1_HUMAN Sphingosine 1-phosphate receptor 1 OS=Homo sapiens OX=9606 GN=S1PR1 PE=1 SV=2
6	Q9DDK4	2.13e-131	382	362	0.521	0.544	S1PR1_DANRE Sphingosine 1-phosphate receptor 1 OS=Danio rerio OX=7955 GN=s1pr1 PE=2 SV=2
7	Q9I8K8	2.00e-105	317	370	0.434	0.443	S1PR2_DANRE Sphingosine 1-phosphate receptor 2 OS=Danio rerio OX=7955 GN=s1pr2 PE=1 SV=1
8	P52592	5.57e-99	299	352	0.399	0.429	S1PR2_MOUSE Sphingosine 1-phosphate receptor 2 OS=Mus musculus OX=10090 GN=S1pr2 PE=1 SV=3
9	P47752	1.22e-98	298	352	0.399	0.429	S1PR2_RAT Sphingosine 1-phosphate receptor 2 OS=Rattus norvegicus OX=10116 GN=S1pr2 PE=1 SV=1
10	O95136	3.21e-96	292	353	0.399	0.428	S1PR2_HUMAN Sphingosine 1-phosphate receptor 2 OS=Homo sapiens OX=9606 GN=S1PR2 PE=1 SV=2
11	F1QC10	1.92e-91	281	389	0.399	0.388	F1QC10_DANRE Sphingosine 1-phosphate receptor 4 OS=Danio rerio OX=7955 GN=edg6 PE=3 SV=1
12	Q9H228	3.38e-88	273	398	0.413	0.392	S1PR5_HUMAN Sphingosine 1-phosphate receptor 5 OS=Homo sapiens OX=9606 GN=S1PR5 PE=1 SV=1
13	Q91X56	2.42e-87	271	400	0.399	0.378	S1PR5_MOUSE Sphingosine 1-phosphate receptor 5 OS=Mus musculus OX=10090 GN=S1pr5 PE=1 SV=1
14	Q9JKM5	3.39e-87	271	400	0.397	0.375	S1PR5_RAT Sphingosine 1-phosphate receptor 5 OS=Rattus norvegicus OX=10116 GN=S1pr5 PE=1 SV=1
15	Q9Z0L1	9.54e-75	238	386	0.376	0.368	S1PR4_MOUSE Sphingosine 1-phosphate receptor 4 OS=Mus musculus OX=10090 GN=S1pr4 PE=2 SV=1
16	O95977	1.20e-70	228	384	0.373	0.367	S1PR4_HUMAN Sphingosine 1-phosphate receptor 4 OS=Homo sapiens OX=9606 GN=S1PR4 PE=1 SV=1
17	Q6DHQ8	2.64e-64	210	346	0.323	0.353	Q6DHQ8_DANRE Lysophosphatidic acid receptor 1 OS=Danio rerio OX=7955 GN=edg2 PE=2 SV=1
18	Q92633	2.07e-63	208	364	0.325	0.338	LPAR1_HUMAN Lysophosphatidic acid receptor 1 OS=Homo sapiens OX=9606 GN=LPAR1 PE=1 SV=3
19	P61793	2.28e-63	208	364	0.325	0.338	LPAR1_MOUSE Lysophosphatidic acid receptor 1 OS=Mus musculus OX=10090 GN=Lpar1 PE=1 SV=1
20	P61794	2.28e-63	208	364	0.325	0.338	LPAR1_RAT Lysophosphatidic acid receptor 1 OS=Rattus norvegicus OX=10116 GN=Lpar1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	3.4e-34	129.9	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	14	16.9	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	3e-05	35.1	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF00335 Tetraspanin	2.2	19.4	Tetraspanin family
5	PF14037 YoqO	6.2e+02	12.3	YoqO-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365006

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286548	0.998	Guanine nucleotide-binding protein G(q) subunit alpha
2	9606.ENSP00000275364	0.962	Guanine nucleotide-binding protein subunit alpha-12
3	9606.ENSP00000451828	0.953	RAC-alpha serine/threonine-protein kinase
4	9606.ENSP00000400717	0.951	Guanine nucleotide-binding protein subunit alpha-13
5	9606.ENSP00000400175	0.947	Transforming protein RhoA
6	9606.ENSP00000262958	0.946	Guanine nucleotide-binding protein subunit alpha-15
7	9606.ENSP00000386884	0.946	C-X-C chemokine receptor type 4
8	9606.ENSP00000263025	0.938	Mitogen-activated protein kinase 3
9	9606.ENSP00000078429	0.935	Guanine nucleotide-binding protein subunit alpha-11
10	9606.ENSP00000343027	0.923	Guanine nucleotide-binding protein G(i) subunit alpha-1
11	9606.ENSP00000362680	0.922	Proto-oncogene tyrosine-protein kinase Src
12	9606.ENSP00000230990	0.918	Proheparin-binding EGF-like growth factor
13	9606.ENSP00000262494	0.914	Guanine nucleotide-binding protein G(o) subunit alpha
14	9606.ENSP00000312999	0.914	Guanine nucleotide-binding protein G(i) subunit alpha-2
15	9606.ENSP00000358867	0.908	Guanine nucleotide-binding protein G(k) subunit alpha
16	9606.ENSP00000478892	0.907	Guanine nucleotide-binding protein G(z) subunit alpha
17	9606.ENSP00000348461	0.906	Ras-related C3 botulinum toxin substrate 1
18	9606.ENSP00000215832	0.903	Mitogen-activated protein kinase 1
19	9606.ENSP00000365807	0.900	Guanine nucleotide-binding protein subunit alpha-14
20	9606.ENSP00000313681	0.858	Sphingosine kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005488	0.998	binding
GO:0005515	0.988	protein binding
GO:0005102	0.473	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.997	signal transduction
GO:0007186	0.988	G protein-coupled receptor signaling pathway
GO:0048522	0.796	positive regulation of cellular process
GO:0051239	0.450	regulation of multicellular organismal process
GO:0048519	0.439	negative regulation of biological process
GO:0048523	0.416	negative regulation of cellular process
GO:0006950	0.399	response to stress
GO:0019222	0.386	regulation of metabolic process
GO:0065008	0.381	regulation of biological quality
GO:0048583	0.370	regulation of response to stimulus
GO:0032501	0.369	multicellular organismal process
GO:0042221	0.348	response to chemical
GO:0060255	0.348	regulation of macromolecule metabolic process
GO:0010646	0.334	regulation of cell communication
GO:0023051	0.333	regulation of signaling
GO:0048856	0.325	anatomical structure development
GO:0040012	0.303	regulation of locomotion
GO:0009966	0.303	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.630	intracellular anatomical structure
GO:0043226	0.567	organelle
GO:0043229	0.513	intracellular organelle
GO:0043227	0.312	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]