StarFunc result for job id Q99502

User Input

>input (592 residues)
MEMQDLTSPHSRLSGSSESPSGPKLGNSHINSNSMTPNGTEVKTEPMSSSETASTTADGS
LNNFSGSAIGSSSFSPRPTHQFSPPQIYPSNRPYPHILPTPSSQTMAAYGQTQFTTGMQQ
ATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSFSTPQPGQAPY
SYQMQGSSFTTSSGIYTGNNSLTNSSGFNSSQQDYPSYPSFGQGQYAQYYNSSPYPAHYM
TSSNTSPTTPSTNATYQLQEPPSGITSQAVTDPTAEYSTIHSPSTPIKDSDSDRLRRGSD
GKSRGRGRRNNNPSPPPDSDLERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGL
RMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSANLCL
ATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLT
LALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFER
IIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRISSHSDLMALHHALELEYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Y6K4	0.493	0.470	2.092E-73	621	1.000	0.953	A0A2R8Y6K4.pdb.gz	A0A2R8Y6K4_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
2	AFDB:F1QNU4	0.491	0.477	1.253E-69	609	0.885	0.860	F1QNU4.pdb.gz
3	AFDB:A0A2R8YET7	0.423	0.427	8.623E-65	586	0.939	0.949	A0A2R8YET7.pdb.gz	A0A2R8YET7_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
4	AFDB:F1LX86	0.529	0.531	1.539E-58	589	0.715	0.718	F1LX86.pdb.gz	F1LX86_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya4 PE=3 SV=4
5	AFDB:Q9Z191	0.505	0.486	1.619E-58	616	0.715	0.687	Q9Z191.pdb.gz	EYA4_MOUSE Eyes absent homolog 4 OS=Mus musculus OX=10090 GN=Eya4 PE=2 SV=2
6	AFDB:A0A0R4IA41	0.501	0.467	3.167E-55	638	0.684	0.635	A0A0R4IA41.pdb.gz	A0A0R4IA41_DANRE Eyes absent homolog OS=Danio rerio OX=7955 GN=im:7221408 PE=3 SV=2
7	PDB:1ynsA	0.174	0.364	7.537E-4	254	0.052	0.122	1ynsA.pdb.gz	Crystal structure of human e1 enzyme and its complex with a substrate analog reveals the mechanism of its phosphatase/enolase
8	PDB:1te2A	0.172	0.430	6.382E-3	218	0.051	0.138	1te2A.pdb.gz	Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12
9	PDB:2w4mA	0.183	0.389	6.715E-3	250	0.086	0.204	2w4mA.pdb.gz
10	PDB:3k1zA	0.194	0.443	2.651E-2	241	0.064	0.158	3k1zA.pdb.gz
11	PDB:5olwA	0.180	0.434	5.983E-2	224	0.064	0.170	5olwA.pdb.gz	Observing enzyme ternary transition state analogue complexes by19F NMR spectroscopy.
12	PDB:5aljA	0.191	0.214	8.118E-2	523	0.041	0.046	5aljA.pdb.gz	Successful Generation of Structural Information for Fragment-Based Drug Discovery.
13	PDB:2g80A	0.151	0.352	1.350E-1	225	0.046	0.120	2g80A.pdb.gz	Crystal structure of UTR4 protein (Unknown transcript 4 protein) (yel038w) from Saccharomyces cerevisiae at 2.28 A resolution
14	PDB:4haiA	0.192	0.206	1.420E-1	548	0.051	0.055	4haiA.pdb.gz	Synthesis and structure-activity relationship of piperidine-derived non-urea soluble epoxide hydrolase inhibitors.
15	PDB:6hyjB	0.131	0.312	1.832E-1	223	0.035	0.094	6hyjB.pdb.gz	Crystal structures and snapshots along the reaction pathway of human phosphoserine phosphatase.
16	PDB:7ef7A	0.175	0.398	2.362E-1	236	0.061	0.153	7ef7A.pdb.gz	Initiation of cytosolic plant purine nucleotide catabolism involves a monospecific xanthosine monophosphate phosphatase.
17	AFDB:Q86AT9	0.110	0.049	9.921E-1	1736	0.137	0.047	Q86AT9.pdb.gz	DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum OX=44689 GN=dhkI-1 PE=3 SV=1
18	AFDB:Q5AMQ6	0.080	0.052	2.887	1111	0.132	0.070	Q5AMQ6.pdb.gz	RFX2_CANAL RFX-like DNA-binding protein RFX2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RFX2 PE=2 SV=2
19	AFDB:Q10435	0.068	0.031	3.038	1647	0.128	0.046	Q10435.pdb.gz	YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC12B10.01c PE=3 SV=2
20	AFDB:Q8CB87	0.089	0.063	3.038	973	0.139	0.084	Q8CB87.pdb.gz	RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus OX=10090 GN=Rab44 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZ01	545	602	0.500	0.492	A0A0G2JZ01_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya3 PE=1 SV=2
2	A0A0R4IA41	717	638	0.672	0.624	A0A0R4IA41_DANRE Eyes absent homolog OS=Danio rerio OX=7955 GN=im:7221408 PE=3 SV=2
3	A0A2R8Y6K4	1222	621	1.000	0.953	A0A2R8Y6K4_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
4	A0A2R8YET7	1102	586	0.941	0.951	A0A2R8YET7_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
5	A0A2R8YGM9	1095	585	0.938	0.949	A0A2R8YGM9_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
6	A0A8I6A7V1	800	585	0.694	0.703	A0A8I6A7V1_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya4 PE=3 SV=1
7	A0A8I6AMN9	544	572	0.500	0.517	A0A8I6AMN9_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya3 PE=1 SV=1
8	A0A8I6AS60	811	558	0.684	0.726	A0A8I6AS60_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya4 PE=3 SV=1
9	A0A8I6B402	842	616	0.721	0.693	A0A8I6B402_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya4 PE=3 SV=1
10	A6NCB9	1194	586	0.988	0.998	A6NCB9_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=2
11	E7EQM5	1131	558	0.927	0.984	E7EQM5_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
12	E7ETN2	612	508	0.534	0.622	E7ETN2_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA2 PE=1 SV=1
13	E9QGZ3	729	636	0.684	0.637	E9QGZ3_DANRE Eyes absent homolog OS=Danio rerio OX=7955 GN=im:7221408 PE=3 SV=1
14	E9QIR1	743	613	0.686	0.662	E9QIR1_DANRE Eyes absent homolog OS=Danio rerio OX=7955 GN=im:7221408 PE=3 SV=1
15	F1LX86	853	639	0.738	0.684	F1LX86_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya4 PE=3 SV=4
16	F8WB53	1214	591	0.997	0.998	F8WB53_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
17	O00167	678	538	0.574	0.632	EYA2_HUMAN Eyes absent homolog 2 OS=Homo sapiens OX=9606 GN=EYA2 PE=1 SV=2
18	O08575	686	532	0.588	0.654	EYA2_MOUSE Eyes absent homolog 2 OS=Mus musculus OX=10090 GN=Eya2 PE=1 SV=1
19	O95677	856	639	0.736	0.682	EYA4_HUMAN Eyes absent homolog 4 OS=Homo sapiens OX=9606 GN=EYA4 PE=1 SV=2
20	P97767	1154	591	0.961	0.963	EYA1_MOUSE Eyes absent homolog 1 OS=Mus musculus OX=10090 GN=Eya1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342626

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247182	0.999	Homeobox protein SIX1
2	9606.ENSP00000304502	0.987	Homeobox protein SIX2
3	9606.ENSP00000482245	0.979	Dachshund homolog 1
4	9606.ENSP00000323588	0.977	Transcription factor SOX-2
5	9606.ENSP00000434024	0.970	Histone H2AX
6	9606.ENSP00000316842	0.961	Homeobox protein SIX5
7	9606.ENSP00000359215	0.942	T-cell leukemia homeobox protein 1
8	9606.ENSP00000359319	0.930	Paired box protein Pax-2
9	9606.ENSP00000216513	0.916	Homeobox protein SIX4
10	9606.ENSP00000358151	0.916	Histone H2B type 2-E
11	9606.ENSP00000381698	0.915	Sharpin
12	9606.ENSP00000278616	0.914	Serine-protein kinase ATM
13	9606.ENSP00000432770	0.911	Eyes absent homolog 4
14	9606.ENSP00000362978	0.905	Eyes absent homolog 3
15	9606.ENSP00000366618	0.904	Histone H2B type 1-L
16	9606.ENSP00000477527	0.904	Histone H2B type 1-O
17	9606.ENSP00000479169	0.904	Histone H2B type 1-H
18	9606.ENSP00000482674	0.904	Histone H2B type 1-B
19	9606.ENSP00000483903	0.904	Histone H2B type 1-N
20	9606.ENSP00000333640	0.902	Eyes absent homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:1901363	0.517	heterocyclic compound binding
GO:0097159	0.517	organic cyclic compound binding
GO:0003676	0.501	nucleic acid binding
GO:0043167	0.314	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.980	multicellular organismal process
GO:0048856	0.979	anatomical structure development
GO:0007275	0.937	multicellular organism development
GO:0009653	0.913	anatomical structure morphogenesis
GO:0048513	0.911	animal organ development
GO:0050794	0.905	regulation of cellular process
GO:0009987	0.900	cellular process
GO:0048731	0.878	system development
GO:0048839	0.857	inner ear development
GO:0019222	0.842	regulation of metabolic process
GO:0060255	0.823	regulation of macromolecule metabolic process
GO:0031323	0.823	regulation of cellular metabolic process
GO:0051171	0.822	regulation of nitrogen compound metabolic process
GO:0071599	0.822	otic vesicle development
GO:0080090	0.815	regulation of primary metabolic process
GO:0048518	0.794	positive regulation of biological process
GO:0048522	0.775	positive regulation of cellular process
GO:0019219	0.761	regulation of nucleobase-containing compound metabolic process
GO:0009887	0.747	animal organ morphogenesis
GO:0035239	0.740	tube morphogenesis
GO:0009790	0.709	embryo development
GO:0048598	0.703	embryonic morphogenesis
GO:0042472	0.643	inner ear morphogenesis
GO:0050896	0.577	response to stimulus
GO:0009893	0.522	positive regulation of metabolic process
GO:0071600	0.522	otic vesicle morphogenesis
GO:0007399	0.505	nervous system development
GO:0010604	0.505	positive regulation of macromolecule metabolic process
GO:0051173	0.499	positive regulation of nitrogen compound metabolic process
GO:0031325	0.499	positive regulation of cellular metabolic process
GO:0045935	0.477	positive regulation of nucleobase-containing compound metabolic process
GO:0051716	0.462	cellular response to stimulus
GO:0010468	0.408	regulation of gene expression
GO:0044238	0.359	primary metabolic process
GO:0071704	0.357	organic substance metabolic process
GO:0010556	0.351	regulation of macromolecule biosynthetic process
GO:0048519	0.335	negative regulation of biological process
GO:0048523	0.312	negative regulation of cellular process
GO:0006807	0.308	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.980	nuclear body
GO:0005737	0.531	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]