StarFunc result for job id Q99504

User Input

>input (573 residues)
MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYI
PRSSNDYTSQMYSAKPYAHILSVPVSETAYPGQTQYQTLQQTQPYAVYPQATQTYGLPPF
GALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSST
IANIPAAAVASISNQDYPTYTILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSE
KPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDS
ELERVFLWDLDETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEVADTHLFFNDL
EECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYR
KVREIYDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVL
ITTTQLVPALAKVLLYGLGEIFPIENIYSATKIGKESCFERIVSRFGKKVTYVVIGDGRD
EEIAAKQHNMPFWRITNHGDLVSLHQALELDFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LX86	0.487	0.474	2.428E-48	589	0.534	0.520	F1LX86.pdb.gz	F1LX86_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya4 PE=3 SV=4
2	AFDB:Q9Z191	0.479	0.447	3.915E-47	616	0.534	0.497	Q9Z191.pdb.gz	EYA4_MOUSE Eyes absent homolog 4 OS=Mus musculus OX=10090 GN=Eya4 PE=2 SV=2
3	AFDB:A0A0R4IA41	0.517	0.466	4.342E-46	638	0.510	0.458	A0A0R4IA41.pdb.gz	A0A0R4IA41_DANRE Eyes absent homolog OS=Danio rerio OX=7955 GN=im:7221408 PE=3 SV=2
4	AFDB:A0A2R8Y6K4	0.468	0.432	1.077E-45	621	0.520	0.480	A0A2R8Y6K4.pdb.gz	A0A2R8Y6K4_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
5	AFDB:F1QNU4	0.478	0.451	1.743E-45	609	0.487	0.458	F1QNU4.pdb.gz
6	AFDB:A0A2R8YET7	0.409	0.402	4.441E-37	586	0.475	0.464	A0A2R8YET7.pdb.gz	A0A2R8YET7_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
7	PDB:1ynsA	0.194	0.393	7.327E-4	254	0.056	0.126	1ynsA.pdb.gz	Crystal structure of human e1 enzyme and its complex with a substrate analog reveals the mechanism of its phosphatase/enolase
8	PDB:1te2A	0.179	0.430	3.844E-3	218	0.061	0.161	1te2A.pdb.gz	Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12
9	PDB:3k1zA	0.195	0.425	8.126E-3	241	0.065	0.154	3k1zA.pdb.gz
10	PDB:2w4mA	0.190	0.391	2.932E-2	250	0.066	0.152	2w4mA.pdb.gz
11	PDB:5aljA	0.161	0.175	3.442E-2	523	0.030	0.033	5aljA.pdb.gz	Successful Generation of Structural Information for Fragment-Based Drug Discovery.
12	PDB:2g80A	0.166	0.372	3.831E-2	225	0.045	0.116	2g80A.pdb.gz	Crystal structure of UTR4 protein (Unknown transcript 4 protein) (yel038w) from Saccharomyces cerevisiae at 2.28 A resolution
13	PDB:4g9bA	0.176	0.412	4.263E-2	227	0.061	0.154	4g9bA.pdb.gz	Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
14	PDB:7ena3	0.138	0.232	4.497E-2	295	0.070	0.136	7ena3.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
15	PDB:2b0cA	0.155	0.410	6.539E-2	199	0.049	0.141	2b0cA.pdb.gz	The 2.0A crystal structure of the putative phosphatase from Escherichia coli
16	PDB:4haiA	0.203	0.211	7.277E-2	548	0.051	0.053	4haiA.pdb.gz	Synthesis and structure-activity relationship of piperidine-derived non-urea soluble epoxide hydrolase inhibitors.
17	AFDB:F1NW90	0.074	0.057	6.700E-1	823	0.112	0.078	F1NW90.pdb.gz	F1NW90_CHICK Neural precursor cell expressed, developmentally down-regulated 9 OS=Gallus gallus OX=9031 GN=NEDD9 PE=3 SV=4
18	AFDB:O35177	0.056	0.045	7.866E-1	833	0.129	0.089	O35177.pdb.gz	CASL_MOUSE Enhancer of filamentation 1 OS=Mus musculus OX=10090 GN=Nedd9 PE=1 SV=2
19	AFDB:Q38BL9	0.075	0.051	1.144	1008	0.106	0.061	Q38BL9.pdb.gz	Q38BL9_TRYB2 RING-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3560 PE=4 SV=1
20	AFDB:Q7SYD5	0.071	0.050	3.332	1254	0.147	0.067	Q7SYD5.pdb.gz	SC31A_DANRE Protein transport protein Sec31A OS=Danio rerio OX=7955 GN=sec31a PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZ01	1087	602	0.951	0.905	A0A0G2JZ01_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya3 PE=1 SV=2
2	A0A2R8Y6K4	560	621	0.511	0.472	A0A2R8Y6K4_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
3	A0A8I6A077	971	561	0.873	0.891	A0A8I6A077_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya3 PE=1 SV=1
4	A0A8I6A7V1	601	585	0.555	0.544	A0A8I6A7V1_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya4 PE=3 SV=1
5	A0A8I6AMN9	1087	572	0.951	0.953	A0A8I6AMN9_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya3 PE=1 SV=1
6	A0A8I6AS60	597	558	0.525	0.539	A0A8I6AS60_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya4 PE=3 SV=1
7	A0A8I6B402	597	616	0.525	0.489	A0A8I6B402_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya4 PE=3 SV=1
8	A6NCB9	549	586	0.504	0.493	A6NCB9_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=2
9	B1APR7	838	416	0.709	0.976	B1APR7_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA3 PE=1 SV=1
10	D3ZHX6	891	496	0.820	0.948	D3ZHX6_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya3 PE=3 SV=2
11	E7EQM5	564	558	0.511	0.525	E7EQM5_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
12	F1LX86	592	639	0.520	0.466	F1LX86_RAT Eyes absent homolog OS=Rattus norvegicus OX=10116 GN=Eya4 PE=3 SV=4
13	F8WB53	565	591	0.511	0.496	F8WB53_HUMAN Eyes absent homolog OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=1
14	O95677	586	639	0.520	0.466	EYA4_HUMAN Eyes absent homolog 4 OS=Homo sapiens OX=9606 GN=EYA4 PE=1 SV=2
15	P97480	911	510	0.845	0.949	EYA3_MOUSE Eyes absent homolog 3 OS=Mus musculus OX=10090 GN=Eya3 PE=1 SV=2
16	P97767	563	591	0.510	0.494	EYA1_MOUSE Eyes absent homolog 1 OS=Mus musculus OX=10090 GN=Eya1 PE=1 SV=3
17	Q6P4T3	944	526	0.873	0.951	Q6P4T3_MOUSE Eyes absent homolog OS=Mus musculus OX=10090 GN=Eya3 PE=1 SV=1
18	Q99502	560	592	0.511	0.495	EYA1_HUMAN Eyes absent homolog 1 OS=Homo sapiens OX=9606 GN=EYA1 PE=1 SV=2
19	Q99504	1187	573	1.000	1.000	EYA3_HUMAN Eyes absent homolog 3 OS=Homo sapiens OX=9606 GN=EYA3 PE=1 SV=3
20	Q9Z191	598	616	0.525	0.489	EYA4_MOUSE Eyes absent homolog 4 OS=Mus musculus OX=10090 GN=Eya4 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362978

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247182	0.971	Homeobox protein SIX1
2	9606.ENSP00000304502	0.970	Homeobox protein SIX2
3	9606.ENSP00000434024	0.947	Histone H2AX
4	9606.ENSP00000278616	0.922	Serine-protein kinase ATM
5	9606.ENSP00000265433	0.915	Nibrin
6	9606.ENSP00000333640	0.906	Eyes absent homolog 2
7	9606.ENSP00000342626	0.905	Eyes absent homolog 1
8	9606.ENSP00000432770	0.904	Eyes absent homolog 4
9	9606.ENSP00000358151	0.903	Histone H2B type 2-E
10	9606.ENSP00000325863	0.901	Double-strand break repair protein MRE11
11	9606.ENSP00000274764	0.900	Histone H2B type 1-A
12	9606.ENSP00000289316	0.900	Histone H2B type 1-D
13	9606.ENSP00000340330	0.900	Histone acetyltransferase KAT5
14	9606.ENSP00000349430	0.900	Histone H2B type 1-K
15	9606.ENSP00000355657	0.900	Histone H3.1t
16	9606.ENSP00000366618	0.900	Histone H2B type 1-L
17	9606.ENSP00000368100	0.900	DNA repair protein RAD50
18	9606.ENSP00000476136	0.900	Histone H2B type 1-J
19	9606.ENSP00000477527	0.900	Histone H2B type 1-O
20	9606.ENSP00000477907	0.900	Histone H2B type 1-M

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.979	catalytic activity
GO:0016791	0.801	phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.977	cellular process
GO:0050794	0.955	regulation of cellular process
GO:0048856	0.947	anatomical structure development
GO:0048518	0.947	positive regulation of biological process
GO:0048522	0.934	positive regulation of cellular process
GO:0050896	0.923	response to stimulus
GO:2001022	0.912	positive regulation of response to DNA damage stimulus
GO:0051054	0.912	positive regulation of DNA metabolic process
GO:0045739	0.889	positive regulation of DNA repair
GO:0071704	0.887	organic substance metabolic process
GO:0044238	0.862	primary metabolic process
GO:0044237	0.859	cellular metabolic process
GO:0006807	0.843	nitrogen compound metabolic process
GO:0006950	0.837	response to stress
GO:0043170	0.833	macromolecule metabolic process
GO:0032501	0.784	multicellular organismal process
GO:0051716	0.781	cellular response to stimulus
GO:0006974	0.518	cellular response to DNA damage stimulus
GO:0046483	0.485	heterocycle metabolic process
GO:1901360	0.395	organic cyclic compound metabolic process
GO:0006725	0.394	cellular aromatic compound metabolic process
GO:0006139	0.343	nucleobase-containing compound metabolic process
GO:0090304	0.311	nucleic acid metabolic process
GO:0009889	0.303	regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.990	nucleoplasm
GO:0043232	0.689	intracellular non-membrane-bounded organelle
GO:0005829	0.403	cytosol
GO:0016604	0.396	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	0.801	Phosphoric monoester hydrolases.

[back to server]