StarFunc result for job id Q99527

User Input

>input (375 residues)
MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLF
LSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLH
ERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGL
IWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRV
LVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRH
AHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVI
PDSTEQSDVRFSSAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R849	0.822	0.822	7.744E-43	375	1.000	1.000	A0A024R849.pdb.gz
2	AFDB:O08878	0.809	0.809	1.206E-39	375	0.861	0.861	O08878.pdb.gz	GPER1_RAT G-protein coupled estrogen receptor 1 OS=Rattus norvegicus OX=10116 GN=Gper1 PE=1 SV=1
3	AFDB:I3LSZ2	0.825	0.858	4.870E-36	360	0.768	0.800	I3LSZ2.pdb.gz	I3LSZ2_PIG G-protein coupled estrogen receptor 1 OS=Sus scrofa OX=9823 GN=GPER1 PE=3 SV=2
4	AFDB:B0F9W3	0.784	0.829	9.306E-31	354	0.640	0.678	B0F9W3.pdb.gz	GPER1_MICUN G-protein coupled estrogen receptor 1 OS=Micropogonias undulatus OX=29154 GN=gper1 PE=1 SV=1
5	AFDB:B3G515	0.783	0.830	9.306E-31	353	0.621	0.660	B3G515.pdb.gz	GPER1_DANRE G-protein coupled estrogen receptor 1 OS=Danio rerio OX=7955 GN=gper1 PE=1 SV=1
6	AFDB:A0A2S1XYZ5	0.656	0.653	9.443E-14	377	0.251	0.249	A0A2S1XYZ5.pdb.gz	A0A2S1XYZ5_DANRE G-protein coupled receptor 25 OS=Danio rerio OX=7955 GN=gpr25 PE=2 SV=1
7	AFDB:P30935	0.636	0.566	2.137E-13	428	0.237	0.208	P30935.pdb.gz	SSR3_MOUSE Somatostatin receptor type 3 OS=Mus musculus OX=10090 GN=Sstr3 PE=2 SV=2
8	AFDB:F1QYD4	0.628	0.656	3.072E-13	358	0.235	0.246	F1QYD4.pdb.gz	F1QYD4_DANRE C-C chemokine receptor type 5-like OS=Danio rerio OX=7955 GN=si:ch211-207g17.3 PE=3 SV=3
9	AFDB:P32745	0.623	0.563	3.684E-13	418	0.243	0.218	P32745.pdb.gz	SSR3_HUMAN Somatostatin receptor type 3 OS=Homo sapiens OX=9606 GN=SSTR3 PE=1 SV=1
10	AFDB:P49238	0.629	0.662	3.684E-13	355	0.251	0.265	P49238.pdb.gz	CX3C1_HUMAN CX3C chemokine receptor 1 OS=Homo sapiens OX=9606 GN=CX3CR1 PE=1 SV=1
11	PDB:7wicR	0.588	0.750	1.124E-10	288	0.192	0.250	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
12	PDB:7vl9R	0.605	0.735	1.038E-9	302	0.205	0.255	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
13	PDB:7wq3R	0.586	0.743	1.189E-9	289	0.197	0.256	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
14	PDB:7ezmD	0.591	0.718	1.492E-9	304	0.171	0.211	7ezmD.pdb.gz	Ligand recognition and G-protein coupling selectivity of cholecystokinin A receptor
15	PDB:7sk8A	0.575	0.692	1.492E-9	306	0.219	0.268	7sk8A.pdb.gz	Structures of atypical chemokine receptor 3 reveal the basis for its promiscuity and signaling bias.
16	PDB:7f1qR	0.566	0.577	1.634E-9	367	0.200	0.204	7f1qR.pdb.gz
17	PDB:6lfmR	0.578	0.696	2.050E-9	307	0.219	0.267	6lfmR.pdb.gz	Structural basis of CXC chemokine receptor 2 activation and signalling.
18	PDB:8ef5M	0.570	0.722	2.145E-9	288	0.200	0.260	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
19	PDB:6wwzR	0.596	0.710	3.698E-9	310	0.192	0.232	6wwzR.pdb.gz
20	PDB:7eibA	0.599	0.744	4.434E-9	295	0.208	0.264	7eibA.pdb.gz	Molecular basis for kinin selectivity and activation of the human bradykinin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F7EQ49	0.0	761	375	0.981	0.981	GPER1_MACMU G-protein coupled estrogen receptor 1 OS=Macaca mulatta OX=9544 GN=GPER1 PE=1 SV=1
2	I3LSZ2	0.0	587	360	0.765	0.797	I3LSZ2_PIG G-protein coupled estrogen receptor 1 OS=Sus scrofa OX=9823 GN=GPER1 PE=3 SV=2
3	O08878	0.0	663	375	0.861	0.861	GPER1_RAT G-protein coupled estrogen receptor 1 OS=Rattus norvegicus OX=10116 GN=Gper1 PE=1 SV=1
4	Q8BMP4	0.0	671	375	0.869	0.869	GPER1_MOUSE G-protein coupled estrogen receptor 1 OS=Mus musculus OX=10090 GN=Gper1 PE=1 SV=2
5	Q99527	0.0	771	375	1.000	1.000	GPER1_HUMAN G-protein coupled estrogen receptor 1 OS=Homo sapiens OX=9606 GN=GPER1 PE=1 SV=1
6	B0F9W3	4.94e-171	483	354	0.635	0.672	GPER1_MICUN G-protein coupled estrogen receptor 1 OS=Micropogonias undulatus OX=29154 GN=gper1 PE=1 SV=1
7	B3G515	3.30e-166	470	353	0.603	0.640	GPER1_DANRE G-protein coupled estrogen receptor 1 OS=Danio rerio OX=7955 GN=gper1 PE=1 SV=1
8	C9J3W2	6.67e-46	153	73	0.195	1.000	C9J3W2_HUMAN G protein-coupled estrogen receptor 1 (Fragment) OS=Homo sapiens OX=9606 GN=GPER1 PE=1 SV=1
9	P56484	5.36e-35	133	353	0.261	0.278	CCR8_MOUSE C-C chemokine receptor type 8 OS=Mus musculus OX=10090 GN=Ccr8 PE=2 SV=1
10	P35407	2.94e-33	129	359	0.221	0.231	CXCR2_RAT C-X-C chemokine receptor type 2 OS=Rattus norvegicus OX=10116 GN=Cxcr2 PE=2 SV=2
11	P25104	1.78e-32	127	359	0.264	0.276	AGTR1_BOVIN Type-1 angiotensin II receptor OS=Bos taurus OX=9913 GN=AGTR1 PE=2 SV=1
12	P35343	1.95e-32	127	359	0.227	0.237	CXCR2_MOUSE C-X-C chemokine receptor type 2 OS=Mus musculus OX=10090 GN=Cxcr2 PE=2 SV=1
13	P29755	2.16e-32	126	359	0.280	0.292	AGTRB_MOUSE Type-1 angiotensin II receptor B OS=Mus musculus OX=10090 GN=Agtr1b PE=3 SV=1
14	P32303	2.43e-32	126	362	0.232	0.240	AGTRA_XENLA Type-1 angiotensin II receptor A OS=Xenopus laevis OX=8355 GN=agtr1-a PE=2 SV=2
15	P43240	4.65e-32	125	359	0.264	0.276	AGTR1_CANLF Type-1 angiotensin II receptor OS=Canis lupus familiaris OX=9615 GN=AGTR1 PE=2 SV=1
16	O35210	5.15e-32	125	359	0.261	0.273	AGTR1_MERUN Type-1 angiotensin II receptor OS=Meriones unguiculatus OX=10047 GN=AGTR1 PE=2 SV=1
17	P25095	9.21e-32	125	359	0.264	0.276	AGTRA_RAT Type-1 angiotensin II receptor A OS=Rattus norvegicus OX=10116 GN=Agtr1 PE=1 SV=1
18	P30555	9.30e-32	125	359	0.269	0.281	AGTR1_PIG Type-1 angiotensin II receptor OS=Sus scrofa OX=9823 GN=AGTR1 PE=2 SV=1
19	P32246	1.73e-31	124	355	0.221	0.234	CCR1_HUMAN C-C chemokine receptor type 1 OS=Homo sapiens OX=9606 GN=CCR1 PE=1 SV=1
20	P29089	2.02e-31	124	359	0.248	0.259	AGTRB_RAT Type-1 angiotensin II receptor B OS=Rattus norvegicus OX=10116 GN=Agtr1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1e-38	144.7	7 transmembrane receptor (rhodopsin family)
2	PF10320 7TM_GPCR_Srsx	0.12	23.3	Serpentine type 7TM GPCR chemoreceptor Srsx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380281

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405330	0.985	Estrogen receptor
2	9606.ENSP00000382428	0.957	Disks large homolog 4
3	9606.ENSP00000286548	0.935	Guanine nucleotide-binding protein G(q) subunit alpha
4	9606.ENSP00000360141	0.925	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
5	9606.ENSP00000343925	0.921	Estrogen receptor beta
6	9606.ENSP00000362680	0.915	Proto-oncogene tyrosine-protein kinase Src
7	9606.ENSP00000319250	0.909	Probable G-protein coupled receptor 62
8	9606.ENSP00000432456	0.908	Probable G-protein coupled receptor 61
9	9606.ENSP00000275493	0.839	Epidermal growth factor receptor
10	9606.ENSP00000341189	0.814	Focal adhesion kinase 1
11	9606.ENSP00000354896	0.804	Metabotropic glutamate receptor 1
12	9606.ENSP00000378207	0.749	A-kinase anchor protein 5
13	9606.ENSP00000242249	0.744	Receptor activity-modifying protein 3
14	9606.ENSP00000379683	0.707	Aromatase
15	9606.ENSP00000405573	0.702	Glucose-6-phosphate isomerase
16	9606.ENSP00000345731	0.693	Disks large homolog 1
17	9606.ENSP00000355904	0.681	Estrogen-related receptor gamma
18	9606.ENSP00000325120	0.667	Progesterone receptor
19	9606.ENSP00000217971	0.638	Membrane-associated progesterone receptor component 1
20	9606.ENSP00000451828	0.611	RAC-alpha serine/threonine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030284	1.000	nuclear estrogen receptor activity
GO:0004930	1.000	G protein-coupled receptor activity
GO:0008289	0.999	lipid binding
GO:0005515	0.978	protein binding
GO:0008528	0.920	G protein-coupled peptide receptor activity
GO:0097159	0.910	organic cyclic compound binding
GO:0005496	0.859	steroid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048583	0.989	regulation of response to stimulus
GO:0023051	0.987	regulation of signaling
GO:0010646	0.987	regulation of cell communication
GO:0051716	0.986	cellular response to stimulus
GO:0048518	0.984	positive regulation of biological process
GO:0007154	0.974	cell communication
GO:0042221	0.969	response to chemical
GO:0070372	0.932	regulation of ERK1 and ERK2 cascade
GO:0007165	0.930	signal transduction
GO:0070887	0.907	cellular response to chemical stimulus
GO:0051050	0.898	positive regulation of transport
GO:0071407	0.898	cellular response to organic cyclic compound
GO:0019222	0.885	regulation of metabolic process
GO:0071392	0.877	cellular response to estradiol stimulus
GO:0048522	0.870	positive regulation of cellular process
GO:1901184	0.840	regulation of ERBB signaling pathway
GO:0042058	0.822	regulation of epidermal growth factor receptor signaling pathway
GO:0060255	0.807	regulation of macromolecule metabolic process
GO:0051171	0.795	regulation of nitrogen compound metabolic process
GO:0065008	0.792	regulation of biological quality
GO:0080090	0.792	regulation of primary metabolic process
GO:0031323	0.792	regulation of cellular metabolic process
GO:0048523	0.782	negative regulation of cellular process
GO:1901186	0.752	positive regulation of ERBB signaling pathway
GO:0032501	0.738	multicellular organismal process
GO:0007186	0.704	G protein-coupled receptor signaling pathway
GO:0045742	0.633	positive regulation of epidermal growth factor receptor signaling pathway
GO:0009893	0.573	positive regulation of metabolic process
GO:0051896	0.555	regulation of protein kinase B signaling
GO:0010604	0.549	positive regulation of macromolecule metabolic process
GO:0031325	0.548	positive regulation of cellular metabolic process
GO:1902533	0.535	positive regulation of intracellular signal transduction
GO:0051173	0.532	positive regulation of nitrogen compound metabolic process
GO:0009719	0.489	response to endogenous stimulus
GO:0010468	0.480	regulation of gene expression
GO:0071495	0.472	cellular response to endogenous stimulus
GO:0065009	0.467	regulation of molecular function
GO:0031326	0.465	regulation of cellular biosynthetic process
GO:0019219	0.465	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.463	regulation of macromolecule biosynthetic process
GO:0006355	0.448	regulation of DNA-templated transcription
GO:0042127	0.446	regulation of cell population proliferation
GO:0032502	0.388	developmental process
GO:0042325	0.370	regulation of phosphorylation
GO:0043410	0.359	positive regulation of MAPK cascade
GO:0031399	0.352	regulation of protein modification process
GO:0045937	0.349	positive regulation of phosphate metabolic process
GO:0060341	0.346	regulation of cellular localization
GO:0001934	0.343	positive regulation of protein phosphorylation
GO:0044093	0.339	positive regulation of molecular function
GO:0048856	0.338	anatomical structure development
GO:0008152	0.324	metabolic process
GO:0034765	0.320	regulation of monoatomic ion transmembrane transport
GO:0009892	0.317	negative regulation of metabolic process
GO:0070374	0.312	positive regulation of ERK1 and ERK2 cascade
GO:0045935	0.311	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.307	positive regulation of cellular biosynthetic process
GO:0032880	0.305	regulation of protein localization
GO:1904062	0.302	regulation of monoatomic cation transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.994	cytoplasm
GO:0043231	0.975	intracellular membrane-bounded organelle
GO:0031974	0.954	membrane-enclosed lumen
GO:0070013	0.918	intracellular organelle lumen
GO:0005634	0.900	nucleus
GO:0031981	0.861	nuclear lumen
GO:0005829	0.819	cytosol
GO:0005654	0.642	nucleoplasm
GO:0043228	0.575	non-membrane-bounded organelle
GO:0043232	0.539	intracellular non-membrane-bounded organelle
GO:0012505	0.398	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]