StarFunc result for job id Q99536

User Input

>input (393 residues)
MSDEREVAEAATGEDASSPPPKTEAASDPQHPAASEGAAAAAASPPLLRCLVLTGFGGYD
KVKLQSRPAAPPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA
VGEGVSDRKAGDRVMVLNRSGMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVL
FDFGNLQPGHSVLVHMAAGGVGMAAVQLCRTVENVTVFGTASASKHEALKENGVTHPIDY
HTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMA
LARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSGVVARLLALYNQGHIKPHIDS
VWPFEKVADAMKQMQEKKNVGKVLLVPGPEKEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3MIE4	0.886	0.862	1.876E-76	404	0.903	0.879	Q3MIE4.pdb.gz	VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus OX=10116 GN=Vat1 PE=1 SV=1
2	PDB:6k9yA	0.859	0.986	1.104E-70	342	0.870	1.000	6k9yA.pdb.gz
3	AFDB:Q9HCJ6	0.834	0.784	1.573E-49	419	0.420	0.394	Q9HCJ6.pdb.gz	VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens OX=9606 GN=VAT1L PE=1 SV=2
4	AFDB:O97764	0.759	0.895	4.709E-34	330	0.277	0.330	O97764.pdb.gz	QOR_BOVIN Zeta-crystallin OS=Bos taurus OX=9913 GN=CRYZ PE=2 SV=2
5	AFDB:P11415	0.758	0.897	8.186E-34	329	0.272	0.325	P11415.pdb.gz	QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus OX=10141 GN=CRYZ PE=1 SV=1
6	AFDB:Q3UNZ8	0.776	0.867	8.704E-34	350	0.267	0.300	Q3UNZ8.pdb.gz	QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus OX=10090 GN=Cryzl2 PE=1 SV=1
7	AFDB:A1L4Y4	0.778	0.754	1.423E-33	406	0.257	0.249	A1L4Y4.pdb.gz	A1L4Y4_ARATH At5g61510 OS=Arabidopsis thaliana OX=3702 GN=At5g61510 PE=1 SV=1
8	PDB:1yb5A	0.746	0.897	4.639E-33	324	0.272	0.330	1yb5A.pdb.gz	Crystal Structure of human Zeta-Crystallin at 1.85A
9	AFDB:Q08257	0.758	0.897	5.498E-33	329	0.275	0.328	Q08257.pdb.gz	QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ PE=1 SV=1
10	AFDB:Q6AYT0	0.749	0.887	1.300E-32	329	0.275	0.328	Q6AYT0.pdb.gz	QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus OX=10116 GN=Cryz PE=2 SV=1
11	PDB:2obyA	0.738	0.862	2.027E-32	334	0.267	0.314	2obyA.pdb.gz	Crystal structure of human P53 inducible oxidoreductase (TP53I3, PIG3)
12	AFDB:P72043	0.743	0.882	3.927E-32	328	0.249	0.299	P72043.pdb.gz	P72043_MYCTU Probable oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3777 PE=1 SV=2
13	AFDB:Q53FA7	0.745	0.874	4.722E-32	332	0.267	0.316	Q53FA7.pdb.gz	QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens OX=9606 GN=TP53I3 PE=1 SV=2
14	PDB:1qorA	0.752	0.899	8.352E-30	326	0.239	0.288	1qorA.pdb.gz	Crystal structure of Escherichia coli QOR quinone oxidoreductase complexed with NADPH.
15	PDB:4rvuA	0.756	0.896	8.881E-30	329	0.242	0.289	4rvuA.pdb.gz	Structural views of quinone oxidoreductase from Mycobacterium tuberculosis reveal large conformational changes induced by the co-factor.
16	PDB:3qwaB	0.740	0.866	3.649E-29	332	0.209	0.247	3qwaB.pdb.gz
17	PDB:1wlyA	0.694	0.831	1.862E-27	322	0.247	0.301	1wlyA.pdb.gz
18	PDB:1zsyA	0.719	0.806	3.342E-26	347	0.221	0.251	1zsyA.pdb.gz
19	PDB:2dm6B	0.678	0.786	4.150E-25	333	0.186	0.219	2dm6B.pdb.gz	Crystal structure of anti-configuration of indomethacin and leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase complex reveals the structural basis of broad spectrum indomethacin efficacy
20	PDB:5a3jC	0.695	0.827	6.380E-25	327	0.232	0.278	5a3jC.pdb.gz	Crystal Structure of the Chloroplastic Oxoene Reductase ceQORH from Arabidopsis thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3MIE4	0.0	641	404	0.878	0.854	VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus OX=10116 GN=Vat1 PE=1 SV=1
2	Q99536	0.0	806	393	1.000	1.000	VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2
3	Q9HCJ6	1.07e-107	325	419	0.415	0.389	VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens OX=9606 GN=VAT1L PE=1 SV=2
4	Q6AYT0	2.79e-45	160	329	0.285	0.340	QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus OX=10116 GN=Cryz PE=2 SV=1
5	O97764	3.79e-44	157	330	0.265	0.315	QOR_BOVIN Zeta-crystallin OS=Bos taurus OX=9913 GN=CRYZ PE=2 SV=2
6	Q08257	1.03e-43	156	329	0.282	0.337	QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ PE=1 SV=1
7	P11415	1.73e-43	156	329	0.290	0.347	QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus OX=10141 GN=CRYZ PE=1 SV=1
8	Q53FA7	4.21e-36	136	332	0.257	0.304	QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens OX=9606 GN=TP53I3 PE=1 SV=2
9	Q9ZGI4	9.77e-36	141	3739	0.275	0.029	PIKA2_STRVZ Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 OS=Streptomyces venezuelae OX=54571 GN=pikAII PE=1 SV=1
10	Q3UNZ8	1.66e-35	135	350	0.260	0.291	QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus OX=10090 GN=Cryzl2 PE=1 SV=1
11	A1L4Y4	7.06e-35	134	406	0.265	0.256	A1L4Y4_ARATH At5g61510 OS=Arabidopsis thaliana OX=3702 GN=At5g61510 PE=1 SV=1
12	O65423	1.85e-33	129	325	0.262	0.317	O65423_ARATH AT4g21580/F18E5_200 OS=Arabidopsis thaliana OX=3702 GN=F18E5.200 PE=1 SV=1
13	Q6DNE5	2.72e-33	134	2199	0.262	0.047	Q6DNE5_9CYAN CurH OS=Lyngbya majuscula OX=158786 GN=curH PE=1 SV=1
14	Q59I44	3.34e-32	125	333	0.254	0.300	CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. OX=36773 GN=caa43 PE=1 SV=1
15	W7LKX1	1.22e-30	126	2586	0.252	0.038	FUM1_GIBM7 Highly reducing polyketide synthase FUM1 OS=Gibberella moniliformis (strain M3125 / FGSC 7600) OX=334819 GN=FUM1 PE=2 SV=1
16	P96291	4.98e-30	124	2111	0.239	0.045	P96291_MYCTO Mycocerosic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=mas-2 PE=4 SV=2
17	P96202	4.09e-29	122	2188	0.239	0.043	PPSC_MYCTU Phenolphthiocerol/phthiocerol polyketide synthase subunit C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ppsC PE=1 SV=2
18	Q7TXL8	4.09e-29	122	2188	0.239	0.043	PPSC_MYCBO Phenolphthiocerol/phthiocerol polyketide synthase subunit C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=ppsC PE=1 SV=1
19	P72043	2.43e-28	115	328	0.229	0.274	P72043_MYCTU Probable oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3777 PE=1 SV=2
20	O74489	3.19e-28	115	329	0.247	0.295	QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=zta1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08240 ADH_N	1.4e-05	36.3	Alcohol dehydrogenase GroES-like domain
2	PF00107 ADH_zinc_N	2.1e-14	65.1	Zinc-binding dehydrogenase
3	PF13602 ADH_zinc_N_2	5.4e-17	74.5	Zinc-binding dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347872

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262570	0.776	MICOS complex subunit MIC19
2	9606.ENSP00000279242	0.700	Mitochondrial ribosomal protein L49
3	9606.ENSP00000373570	0.699	5,6-dihydroxyindole-2-carboxylic acid oxidase
4	9606.ENSP00000402758	0.565	Melanocyte protein PMEL
5	9606.ENSP00000367992	0.545	S-formylglutathione hydrolase
6	9606.ENSP00000426638	0.542	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
7	9606.ENSP00000392762	0.511	L-dopachrome tautomerase
8	9606.ENSP00000480492	0.503	Tetraspanin-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016491	0.998	oxidoreductase activity
GO:0005515	0.998	protein binding
GO:0016616	0.503	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.959	biological regulation
GO:0050794	0.947	regulation of cellular process
GO:0010821	0.816	regulation of mitochondrion organization
GO:0009987	0.794	cellular process
GO:0048519	0.707	negative regulation of biological process
GO:0051129	0.700	negative regulation of cellular component organization
GO:0010823	0.694	negative regulation of mitochondrion organization
GO:0008152	0.681	metabolic process
GO:0050793	0.657	regulation of developmental process
GO:0022603	0.588	regulation of anatomical structure morphogenesis
GO:0051093	0.515	negative regulation of developmental process
GO:0071704	0.471	organic substance metabolic process
GO:0044237	0.427	cellular metabolic process
GO:0044281	0.314	small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0012505	0.979	endomembrane system
GO:0031090	0.975	organelle membrane
GO:0070013	0.974	intracellular organelle lumen
GO:0005739	0.971	mitochondrion
GO:0098588	0.958	bounding membrane of organelle
GO:0005576	0.934	extracellular region
GO:0031982	0.918	vesicle
GO:0031967	0.893	organelle envelope
GO:0031410	0.883	cytoplasmic vesicle
GO:0043230	0.876	extracellular organelle
GO:0070062	0.865	extracellular exosome
GO:0031966	0.833	mitochondrial membrane
GO:0031968	0.395	organelle outer membrane
GO:0005741	0.378	mitochondrial outer membrane
GO:0031981	0.322	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.998	Oxidoreductases.
EC:1.1.1.-	0.503	With NAD(+) or NADP(+) as acceptor.

[back to server]