StarFunc result for job id Q99543

User Input

>input (621 residues)
MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELS
EESEDEELQLEEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHP
DKRKAAGEPIKEGDNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFE
VFTPVFERNSRWSNKKNVPKLGDMNSSFEDVDIFYSFWYNFDSWREFSYLDEEEKEKAEC
RDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAE
AKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSC
KTWNHFSDNEAERVKMMEEVEKLCDRLELASLQCLNETLTSCTKEVGKAALEKQIEEINE
QIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVI
ANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQADNATP
SERFEGPYTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRYKELV
EMVKAKKAAQEQVLNASRAKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54103	0.689	0.689	5.515E-76	621	0.942	0.942	P54103.pdb.gz	DNJC2_MOUSE DnaJ homolog subfamily C member 2 OS=Mus musculus OX=10090 GN=Dnajc2 PE=1 SV=2
2	AFDB:Q94216	0.552	0.579	5.970E-35	589	0.356	0.375	Q94216.pdb.gz	Q94216_CAEEL DnaJ homolog subfamily C member 2 OS=Caenorhabditis elegans OX=6239 GN=dnj-11 PE=1 SV=1
3	AFDB:F4J6A8	0.422	0.407	2.513E-29	647	0.343	0.329	F4J6A8.pdb.gz	F4J6A8_ARATH DnaJ and Myb-like DNA-binding domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=ATGLSA1 PE=1 SV=1
4	AFDB:Q9LHS5	0.381	0.361	5.186E-27	663	0.345	0.323	Q9LHS5.pdb.gz	Q9LHS5_ARATH Cell division related protein-like OS=Arabidopsis thaliana OX=3702 GN=ATGLSA2 PE=1 SV=1
5	AFDB:G0RYD6	0.451	0.598	1.611E-23	446	0.254	0.354	G0RYD6.pdb.gz	G0RYD6_CHATD Putative ribosome associated protein OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0006310 PE=1 SV=1
6	AFDB:Q9Y7I8	0.394	0.525	1.748E-22	442	0.267	0.376	Q9Y7I8.pdb.gz	ZUO1_SCHPO Zuotin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=zuo1 PE=1 SV=2
7	AFDB:P32527	0.431	0.588	8.980E-22	433	0.250	0.358	P32527.pdb.gz	ZUO1_YEAST Zuotin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZUO1 PE=1 SV=1
8	AFDB:Q4GZ23	0.370	0.352	3.826E-21	658	0.251	0.237	Q4GZ23.pdb.gz	Q4GZ23_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1960 PE=4 SV=1
9	PDB:7x3kA	0.309	0.698	1.011E-13	262	0.166	0.393	7x3kA.pdb.gz
10	AFDB:Q5F1R6	0.232	0.266	2.956E-7	531	0.147	0.171	Q5F1R6.pdb.gz	DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens OX=9606 GN=DNAJC21 PE=1 SV=2
11	AFDB:Q9C911	0.194	0.192	9.512E-7	630	0.147	0.144	Q9C911.pdb.gz	JJJ1_ARATH DNAJ protein JJJ1 homolog OS=Arabidopsis thaliana OX=3702 GN=JJJ1 PE=1 SV=1
12	PDB:2cjjA	0.092	0.864	7.030E-3	63	0.039	0.381	2cjjA.pdb.gz
13	PDB:6byrA	0.101	0.150	3.405E-1	405	0.050	0.077	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
14	PDB:7vdvX	0.064	0.154	4.106E-1	252	0.045	0.111	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
15	PDB:6lthO	0.063	0.119	5.695E-1	325	0.039	0.074	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
16	PDB:6tdaL	0.078	0.081	1.451	596	0.084	0.087	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
17	PDB:7oqeK	0.084	0.121	1.833	406	0.071	0.108	7oqeK.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
18	PDB:6k15D	0.065	0.130	2.012	305	0.042	0.085	6k15D.pdb.gz	Structure of the RSC complex bound to the nucleosome.
19	PDB:7aoaD	0.079	0.132	2.210	343	0.043	0.079	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
20	PDB:7vdvW	0.075	0.179	2.542	248	0.042	0.105	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54103	0.0	1109	621	0.942	0.942	DNJC2_MOUSE DnaJ homolog subfamily C member 2 OS=Mus musculus OX=10090 GN=Dnajc2 PE=1 SV=2
2	Q7TQ20	0.0	1152	621	0.939	0.939	DNJC2_RAT DnaJ homolog subfamily C member 2 OS=Rattus norvegicus OX=10116 GN=Dnajc2 PE=1 SV=1
3	Q99543	0.0	1275	621	1.000	1.000	DNJC2_HUMAN DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2 PE=1 SV=4
4	Q94216	2.63e-102	324	589	0.362	0.382	Q94216_CAEEL DnaJ homolog subfamily C member 2 OS=Caenorhabditis elegans OX=6239 GN=dnj-11 PE=1 SV=1
5	F4J6A8	1.16e-84	280	647	0.338	0.325	F4J6A8_ARATH DnaJ and Myb-like DNA-binding domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=ATGLSA1 PE=1 SV=1
6	Q9LHS5	1.32e-80	269	663	0.343	0.321	Q9LHS5_ARATH Cell division related protein-like OS=Arabidopsis thaliana OX=3702 GN=ATGLSA2 PE=1 SV=1
7	Q9Y7I8	1.04e-74	248	442	0.225	0.317	ZUO1_SCHPO Zuotin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=zuo1 PE=1 SV=2
8	G0RYD6	1.07e-65	224	446	0.254	0.354	G0RYD6_CHATD Putative ribosome associated protein OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0006310 PE=1 SV=1
9	P32527	1.93e-52	188	433	0.180	0.259	ZUO1_YEAST Zuotin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZUO1 PE=1 SV=1
10	Q4GZ23	1.10e-34	141	658	0.122	0.116	Q4GZ23_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1960 PE=4 SV=1
11	Q5F1R6	3.00e-14	78.2	531	0.132	0.154	DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens OX=9606 GN=DNAJC21 PE=1 SV=2
12	Q9VWL4	1.30e-13	75.9	522	0.090	0.107	Q9VWL4_DROME GH07340p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7556 PE=1 SV=1
13	Q9ASQ2	8.26e-13	72.0	309	0.089	0.178	MAMYB_ARATH Transcription factor MAMYB OS=Arabidopsis thaliana OX=3702 GN=MAMYB PE=1 SV=1
14	Q9C911	1.36e-12	73.2	630	0.097	0.095	JJJ1_ARATH DNAJ protein JJJ1 homolog OS=Arabidopsis thaliana OX=3702 GN=JJJ1 PE=1 SV=1
15	Q96KC8	1.78e-12	72.4	554	0.052	0.058	DNJC1_HUMAN DnaJ homolog subfamily C member 1 OS=Homo sapiens OX=9606 GN=DNAJC1 PE=1 SV=1
16	Q61712	1.65e-11	69.3	552	0.050	0.056	DNJC1_MOUSE DnaJ homolog subfamily C member 1 OS=Mus musculus OX=10090 GN=Dnajc1 PE=1 SV=1
17	Q8S9H7	3.13e-09	60.8	307	0.045	0.091	DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus OX=4151 GN=DIVARICATA PE=2 SV=1
18	Q6FP17	3.22e-08	58.9	623	0.121	0.120	JJJ1_CANGA Negative regulator of PDR1-mediated fluconazole resistance JJJ1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=JJJ1 PE=4 SV=1
19	Q58FS3	7.96e-08	52.4	93	0.039	0.258	RAD_ANTMA Transcription factor RADIALIS OS=Antirrhinum majus OX=4151 GN=RAD PE=1 SV=1
20	Q9C773	9.10e-08	56.2	263	0.039	0.091	Q9C773_ARATH Duplicated homeodomain-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F11B9.1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	2.5e-11	54.8	DnaJ domain
2	PF00249 Myb_DNA-binding	1.2e-15	68.8	Myb-like DNA-binding domain
3	PF13921 Myb_DNA-bind_6	2.7e-08	45.2	Myb-like DNA-binding domain
4	PF16717 RAC_head	2.5e-16	71.8	Ribosome-associated complex head domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368565

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367623	0.999	Heat shock 70 kDa protein 14
2	9606.ENSP00000302961	0.998	Heat shock protein family A member 4
3	9606.ENSP00000432083	0.990	Heat shock cognate 71 kDa protein
4	9606.ENSP00000296464	0.971	Heat shock 70 kDa protein 4L
5	9606.ENSP00000297185	0.968	Stress-70 protein, mitochondrial
6	9606.ENSP00000364802	0.965	Heat shock 70 kDa protein 1A
7	9606.ENSP00000378199	0.962	Heat shock-related 70 kDa protein 2
8	9606.ENSP00000364801	0.961	Heat shock protein family A member 1B
9	9606.ENSP00000364805	0.961	Heat shock 70 kDa protein 1-like
10	9606.ENSP00000324173	0.960	78 kDa glucose-regulated protein
11	9606.ENSP00000254963	0.958	Heat shock protein family A member 12B
12	9606.ENSP00000358211	0.958	Heat shock protein family A member 12A
13	9606.ENSP00000285667	0.953	Heat shock 70 kDa protein 13
14	9606.ENSP00000310219	0.953	Heat shock 70 kDa protein 6
15	9606.ENSP00000254322	0.921	DnaJ homolog subfamily B member 1
16	9606.ENSP00000314030	0.917	DnaJ homolog subfamily A member 2
17	9606.ENSP00000278483	0.908	Protein Hikeshi
18	9606.ENSP00000227322	0.867	Zinc finger protein ZPR1
19	9606.ENSP00000369127	0.867	DnaJ homolog subfamily A member 1
20	9606.ENSP00000310042	0.854	Zinc finger protein 622

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.686	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0080090	0.841	regulation of primary metabolic process
GO:0060255	0.834	regulation of macromolecule metabolic process
GO:0051171	0.834	regulation of nitrogen compound metabolic process
GO:0031323	0.827	regulation of cellular metabolic process
GO:0008152	0.716	metabolic process
GO:0071704	0.713	organic substance metabolic process
GO:0044238	0.706	primary metabolic process
GO:0006807	0.697	nitrogen compound metabolic process
GO:0010556	0.683	regulation of macromolecule biosynthetic process
GO:0031326	0.667	regulation of cellular biosynthetic process
GO:0044237	0.665	cellular metabolic process
GO:0048519	0.664	negative regulation of biological process
GO:0043170	0.650	macromolecule metabolic process
GO:0019219	0.600	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.583	negative regulation of cellular process
GO:0034641	0.573	cellular nitrogen compound metabolic process
GO:0044260	0.444	cellular macromolecule metabolic process
GO:0048518	0.380	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.999	membrane
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005654	0.999	nucleoplasm
GO:0012505	0.985	endomembrane system
GO:0005730	0.839	nucleolus
GO:0031090	0.725	organelle membrane
GO:0031975	0.682	envelope
GO:0031967	0.671	organelle envelope
GO:0032991	0.423	protein-containing complex
GO:0005635	0.403	nuclear envelope
GO:0031965	0.302	nuclear membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]