StarFunc result for job id Q99549

User Input

>input (860 residues)
MEQVAEGARVTAVPVSAADSTEELAEVEEGVGVVGEDNDAAARGAEAFGDSEEDGEDVFE
VEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAKAVRK
DIQRLSLNNDIFEANSDSDQQSETKEDTSPKKKKKKLRQREEKSPDDLKKKKAKAGKLKD
KSKPDLESSLESLVFDLRTKKRISEAKEELKESKKPKKDEVKETKELKKVKKGEIRDLKT
KTREDPKENRKTKKEKFVESQVESESSVLNDSPFPEDDSEGLHSDSREEKQNTKSARERA
GQDMGLEHGFEKPLDSAMSAEEDTDVRGRRKKKTPRKAEDTRENRKLENKNAFLEKKTVP
KKQRNQDRSKSAAELEKLMPVSAQTPKGRRLSGEERGLWSTDSAEEDKETKRNESKEKYQ
KRHDSDKEEKGRKEPKGLKTLKEIRNAFDLFKLTPEEKNDVSENNRKREEIPLDFKTIDD
HKTKENKQSLKERRNTRDETDTWAYIAAEGDQEVLDSVCQADENSDGRQQILSLGMDLQL
EWMKLEDFQKHLDGKDENFAATDAIPSNVLRDAVKNGDYITVKVALNSNEEYNLDQEDSS
GMTLVMLAAAGGQDDLLRLLITKGAKVNGRQKNGTTALIHAAEKNFLTTVAILLEAGAFV
NVQQSNGETALMKACKRGNSDIVRLVIECGADCNILSKHQNSALHFAKQSNNVLVYDLLK
NHLETLSRVAEETIKDYFEARLALLEPVFPIACHRLCEGPDFSTDFNYKPPQNIPEGSGI
LLFIFHANFLGKEVIARLCGPCSVQAVVLNDKFQLPVFLDSHFVYSFSPVAGPNKLFIRL
TEAPSAKVKLLIGAYRVQLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99549	1.000	1.000	0.000	860	1.000	1.000	Q99549.pdb.gz	MPP8_HUMAN M-phase phosphoprotein 8 OS=Homo sapiens OX=9606 GN=MPHOSPH8 PE=1 SV=2
2	PDB:8cs9A	0.173	0.187	1.281E-10	796	0.044	0.048	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
3	PDB:6jd6B	0.182	0.765	3.812E-10	192	0.053	0.240	6jd6B.pdb.gz
4	AFDB:A2ABF9	0.170	0.119	4.311E-10	1267	0.149	0.101	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
5	PDB:6pqpA	0.161	0.223	6.944E-10	615	0.060	0.085	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
6	AFDB:Q9H9B1	0.195	0.131	5.592E-9	1298	0.148	0.098	Q9H9B1.pdb.gz	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
7	PDB:2dvwA	0.179	0.660	5.822E-9	229	0.056	0.210	2dvwA.pdb.gz
8	PDB:4oauC	0.169	0.208	1.830E-8	692	0.056	0.069	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
9	PDB:1bd8A	0.169	0.880	4.623E-8	156	0.047	0.256	1bd8A.pdb.gz
10	AFDB:Q8CGN4	0.147	0.075	5.831E-8	1759	0.159	0.078	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
11	PDB:5vkqA	0.172	0.100	7.151E-8	1499	0.053	0.031	5vkqA.pdb.gz
12	AFDB:F1LW07	0.142	0.148	9.020E-8	825	0.114	0.119	F1LW07.pdb.gz	F1LW07_RAT Protein phosphatase 1, regulatory subunit 13 like OS=Rattus norvegicus OX=10116 GN=Ppp1r13l PE=1 SV=2
13	PDB:6v9hC	0.163	0.498	9.918E-8	270	0.042	0.133	6v9hC.pdb.gz
14	PDB:6mwqA	0.184	0.317	1.168E-7	493	0.055	0.095	6mwqA.pdb.gz
15	PDB:6v9xA	0.159	0.236	1.303E-7	571	0.058	0.088	6v9xA.pdb.gz
16	AFDB:Q5H9F3	0.125	0.064	5.385E-6	1711	0.124	0.063	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
17	AFDB:F1R419	0.144	0.119	5.687E-6	1060	0.109	0.089	F1R419.pdb.gz	F1R419_DANRE Apoptosis-stimulating of p53 protein 2 isoform X1 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
18	AFDB:Q6W2J9	0.159	0.082	7.888E-6	1755	0.142	0.070	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
19	AFDB:F1RCL8	0.124	0.061	1.023E-4	1796	0.127	0.061	F1RCL8.pdb.gz	F1RCL8_DANRE BCL-6 corepressor isoform X1 OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
20	AFDB:A0A0K3AR81	0.073	0.081	3.215E-4	696	0.127	0.157	A0A0K3AR81.pdb.gz	A0A0K3AR81_CAEEL Chromo domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uad-2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MT47	0.0	593	311	0.347	0.958	A0A0A0MT47_HUMAN M-phase phosphoprotein 8 (Fragment) OS=Homo sapiens OX=9606 GN=MPHOSPH8 PE=1 SV=1
2	Q99549	0.0	1750	860	1.000	1.000	MPP8_HUMAN M-phase phosphoprotein 8 OS=Homo sapiens OX=9606 GN=MPHOSPH8 PE=1 SV=2
3	E7FFI8	2.35e-15	82.8	619	0.055	0.076	E7FFI8_DANRE B-cell lymphoma 3 protein homolog OS=Danio rerio OX=7955 GN=bcl3 PE=4 SV=1
4	Q7T163	3.42e-15	82.8	1680	0.064	0.033	KDISB_DANRE Kinase D-interacting substrate of 220 kDa B OS=Danio rerio OX=7955 GN=kidins220b PE=1 SV=3
5	X2JCM1	4.13e-14	79.7	11634	0.062	0.005	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
6	A0A0R4IUB2	4.47e-14	79.3	2580	0.055	0.018	A0A0R4IUB2_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=2
7	M9MRX4	4.75e-14	79.3	13559	0.062	0.004	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
8	A0A5F9ZHT8	6.05e-14	79.0	3891	0.060	0.013	A0A5F9ZHT8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
9	A0A5F9ZHT4	6.53e-14	79.0	3870	0.060	0.013	A0A5F9ZHT4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
10	A0A5F9ZHF7	6.58e-14	79.0	3862	0.060	0.013	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
11	A0A5F9ZI46	6.58e-14	79.0	3882	0.060	0.013	A0A5F9ZI46_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
12	B9EJA2	6.83e-14	78.6	1648	0.056	0.029	CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus OX=10090 GN=Cttnbp2 PE=1 SV=2
13	F1M5N3	7.62e-14	78.6	3966	0.062	0.013	F1M5N3_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
14	Q6GQX6	2.53e-13	76.6	883	0.049	0.048	ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus OX=10090 GN=Anks6 PE=1 SV=2
15	A0A5F9ZGX3	2.65e-13	77.0	3972	0.051	0.011	A0A5F9ZGX3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZHS1	2.69e-13	77.0	3984	0.051	0.011	A0A5F9ZHS1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A0G2JZ56	2.74e-13	77.0	4013	0.052	0.011	A0A0G2JZ56_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
18	A0A0G2KAS9	2.74e-13	77.0	3980	0.052	0.011	A0A0G2KAS9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
19	Q01484	2.78e-13	77.0	3957	0.051	0.011	ANK2_HUMAN Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4
20	A0A5F9ZHR8	2.88e-13	76.6	3939	0.051	0.011	A0A5F9ZHR8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.9e-05	36.1	Ankyrin repeat
2	PF12796 Ank_2	5.8e-15	67.0	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	3.3e-08	44.0	Ankyrin repeat
4	PF13637 Ank_4	2e-11	55.4	Ankyrin repeats (many copies)
5	PF13857 Ank_5	5.3e-12	57.0	Ankyrin repeats (many copies)
6	PF00385 Chromo	1.5e-10	52.1	Chromo (CHRromatin Organisation MOdifier) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355388

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352252	0.988	Histone cluster 1 H3 family member j
2	9606.ENSP00000366999	0.985	Histone cluster 1 H3 family member d
3	9606.ENSP00000482271	0.985	Histone cluster 1 H3 family member e
4	9606.ENSP00000484658	0.985	Histone cluster 1 H3 family member c
5	9606.ENSP00000254810	0.984	H3 histone, family 3B (H3.3B)
6	9606.ENSP00000355657	0.984	Histone H3.1t
7	9606.ENSP00000355778	0.984	Histone H3.3
8	9606.ENSP00000358160	0.984	Histone cluster 1 H3 family member h
9	9606.ENSP00000480826	0.984	Histone cluster 1 H3 family member a
10	9606.ENSP00000483283	0.984	Histone cluster 1 H3 family member i
11	9606.ENSP00000484095	0.984	Histone cluster 1 H3 family member f
12	9606.ENSP00000484638	0.984	Histone cluster 1 H3 family member g
13	9606.ENSP00000484841	0.984	Histone H3.1
14	9606.ENSP00000417509	0.982	Protein TASOR
15	9606.ENSP00000264709	0.981	DNA (cytosine-5)-methyltransferase 3A
16	9606.ENSP00000244537	0.948	Histone cluster 1 H4 family member f
17	9606.ENSP00000011619	0.943	Ran-binding protein 9
18	9606.ENSP00000347168	0.931	Histone cluster 1 H4 family member j
19	9606.ENSP00000366956	0.931	Histone cluster 1 H4 family member h
20	9606.ENSP00000366974	0.931	Histone cluster 1 H4 family member b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0035064	1.000	methylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0071840	0.959	cellular component organization or biogenesis
GO:0016043	0.942	cellular component organization
GO:0006325	0.932	chromatin organization
GO:0019222	0.928	regulation of metabolic process
GO:1902679	0.919	negative regulation of RNA biosynthetic process
GO:0048518	0.904	positive regulation of biological process
GO:0048522	0.887	positive regulation of cellular process
GO:0010468	0.875	regulation of gene expression
GO:0006355	0.831	regulation of DNA-templated transcription
GO:1902275	0.806	regulation of chromatin organization
GO:0033044	0.788	regulation of chromosome organization
GO:1903507	0.771	negative regulation of nucleic acid-templated transcription
GO:0120261	0.733	regulation of heterochromatin organization
GO:2001252	0.713	positive regulation of chromosome organization
GO:0051052	0.667	regulation of DNA metabolic process
GO:1903900	0.663	regulation of viral life cycle
GO:0045069	0.648	regulation of viral genome replication
GO:0045892	0.595	negative regulation of DNA-templated transcription
GO:0031445	0.553	regulation of heterochromatin formation
GO:0044030	0.524	regulation of DNA methylation
GO:0040029	0.502	epigenetic regulation of gene expression
GO:0048525	0.487	negative regulation of viral process
GO:0071704	0.486	organic substance metabolic process
GO:0045071	0.461	negative regulation of viral genome replication
GO:0010629	0.445	negative regulation of gene expression
GO:0006807	0.429	nitrogen compound metabolic process
GO:0043170	0.394	macromolecule metabolic process
GO:0045814	0.354	negative regulation of gene expression, epigenetic
GO:0044087	0.324	regulation of cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005654	0.999	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0016020	0.993	membrane
GO:0005829	0.993	cytosol
GO:0005694	0.976	chromosome
GO:0000785	0.946	chromatin
GO:0005886	0.901	plasma membrane
GO:0005730	0.650	nucleolus
GO:0000792	0.483	heterochromatin
GO:0044815	0.474	DNA packaging complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]