StarFunc result for job id Q99550

User Input

>input (1183 residues)
MEEFDLVKTLHKTSSSVGSDENSLHSLGLNLNTDRSSPHLSTNGVSSFSGKTRPSVIQGT
VEVLTSLMQELQNSGKTDSELWKNCETRWLQLFNLVEKQCQEQIVAQQEQFHNQIQHIQE
EIKNLVKLQTSSASLASCEGNSSNKQVSSESQMGFFSLSSERNESVIHYPESTEPEIQQE
MSTSQPDCNVDSCSVSSGYGTFCISELNLYKSKDPKEFMEHIDVPKGQYVAPAVPAESLV
DGVKNENFYIQTPEECHVSLKEDVSISPGEFEHNFLGENKVSEVYSGKTNSNAITSWAQK
LKQNQPKRAHVEDGGSRSKQGNEQSKKTPIEKSDFAAATHPRAFYLSKPDETPNAWMSDS
GTGLTYWKLEEKDMHHSLPETLEKTFISLSSTDVSPNQSNTSNEMKLPSLKDIYYKKQRE
NKQLPERNLTSASNPNHPPEVLTLDPTLHMKPKQQISGIQPHGLPNALDDRISFSPDSVL
EPSMSSPSDIDSFSQASNVTSQLPGFPKYPSHTKASPVDSWKNQTFQNESRTSSTFPSVY
TITSNDISVNTVDEENTVMVASASVSQSQLPGTANSVPECISLTSLEDPVILSKIRQNLK
EKHARHIADLRAYYESEINSLKQKLEAKEISGVEDWKITNQILVDRCGQLDSALHEATSR
VRTLENKNNLLEIEVNDLRERFSAASSASKILQERIEEMRTSSKEKDNTIIRLKSRLQDL
EEAFENAYKLSDDKEAQLKQENKMFQDLLGEYESLGKEHRRVKDALNTTENKLLDAYTQI
SDLKRMISKLEAQVKQVEHENMLSLRHNSRIHVRPSRANTLATSDVSRRKWLIPGAEYSI
FTGQPLDTQDSNVDNQLEETCSLGHRSPLEKDSSPGSSSTSLLIKKQRETSDTPIMRALK
ELDEGKIFKNWGTQTEKEDTSNINPRQTETSVNASRSPEKCAQQRQKRLNSASQRSSSLP
PSNRKSSTPTKREIMLTPVTVAYSPKRSPKENLSPGFSHLLSKNESSPIRFDILLDDLDT
VPVSTLQRTNPRKQLQFLPLDDSEEKTYSEKATDNHVNHSSCPEPVPNGVKKVSVRTAWE
KNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTKEKDQIEAALSRMPSPGG
RITLQTRLNQEALEDRLERINRELGSVRMTLKKFHVLRTSANL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99550	1.000	1.000	0.000	1183	1.000	1.000	Q99550.pdb.gz	MPP9_HUMAN M-phase phosphoprotein 9 OS=Homo sapiens OX=9606 GN=MPHOSPH9 PE=1 SV=6
2	AFDB:Q9QWI6	0.041	0.038	4.160E-7	1250	0.139	0.131	Q9QWI6.pdb.gz	SRCN1_MOUSE SRC kinase signaling inhibitor 1 OS=Mus musculus OX=10090 GN=Srcin1 PE=1 SV=2
3	AFDB:E7FCY1	0.068	0.071	1.240E-6	1124	0.134	0.141	E7FCY1.pdb.gz	E7FCY1_DANRE Centromere protein J OS=Danio rerio OX=7955 GN=cenpj PE=1 SV=1
4	AFDB:Q54XP9	0.059	0.054	2.812E-6	1297	0.148	0.135	Q54XP9.pdb.gz	Q54XP9_DICDI Centrosomal protein 148 kDa OS=Dictyostelium discoideum OX=44689 GN=DDB_G0278809 PE=4 SV=1
5	AFDB:Q9VQM0	0.072	0.047	2.674E-5	2162	0.162	0.089	Q9VQM0.pdb.gz	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
6	AFDB:Q86SQ0	0.075	0.072	1.285E-4	1253	0.157	0.148	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
7	AFDB:Q8K1N2	0.082	0.079	2.072E-4	1249	0.144	0.136	Q8K1N2.pdb.gz	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
8	AFDB:M9PEK8	0.060	0.073	3.341E-4	933	0.134	0.169	M9PEK8.pdb.gz	M9PEK8_DROME Ensconsin, isoform I OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
9	AFDB:P25822	0.034	0.027	6.174E-4	1533	0.111	0.085	P25822.pdb.gz	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
10	AFDB:Q5JRA6	0.061	0.041	6.610E-4	1907	0.156	0.096	Q5JRA6.pdb.gz	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
11	PDB:6tuyA	0.057	0.094	2.406E-1	667	0.008	0.013	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
12	PDB:3c98B	0.055	0.239	2.576E-1	230	0.009	0.048	3c98B.pdb.gz
13	PDB:2zdiB	0.051	0.509	2.953E-1	106	0.012	0.132	2zdiB.pdb.gz
14	PDB:6r1mB	0.049	0.119	3.624E-1	428	0.009	0.026	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.
15	PDB:7ungi	0.045	0.208	4.154E-1	250	0.021	0.100	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:1h7cA	0.040	0.280	7.170E-1	103	0.014	0.155	1h7cA.pdb.gz
17	PDB:4d2eE	0.045	0.341	7.170E-1	90	0.007	0.089	4d2eE.pdb.gz	Cell-Free Expression and in Meso Crystallisation of an Integral Membrane Kinase for Structure Determination.
18	PDB:1serB	0.051	0.139	7.677E-1	421	0.011	0.031	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
19	PDB:4kxrA	0.054	0.453	9.421E-1	85	0.012	0.165	4kxrA.pdb.gz
20	PDB:7peqAD	0.049	0.078	1.009	678	0.015	0.027	7peqAD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6H5Y1	0.0	1433	991	0.637	0.761	MPP9_MOUSE M-phase phosphoprotein 9 OS=Mus musculus OX=10090 GN=Mphosph9 PE=2 SV=2
2	Q99550	0.0	2128	1031	0.872	1.000	MPP9_HUMAN M-phase phosphoprotein 9 OS=Homo sapiens OX=9606 GN=MPHOSPH9 PE=1 SV=6
3	Q15025	0.035	40.8	636	0.036	0.068	TNIP1_HUMAN TNFAIP3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=2
4	A0A0A0MRZ4	0.047	40.4	619	0.036	0.069	A0A0A0MRZ4_HUMAN TNFAIP3 interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=1
5	Q15075	0.24	38.1	1411	0.027	0.023	EEA1_HUMAN Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2
6	O15083	0.25	38.1	957	0.036	0.045	ERC2_HUMAN ERC protein 2 OS=Homo sapiens OX=9606 GN=ERC2 PE=1 SV=3
7	Q8K3M6	0.26	38.1	957	0.036	0.045	ERC2_RAT ERC protein 2 OS=Rattus norvegicus OX=10116 GN=Erc2 PE=1 SV=1
8	Q6NRG6	0.34	37.4	668	0.044	0.078	SAS6_XENLA Spindle assembly abnormal protein 6 homolog OS=Xenopus laevis OX=8355 GN=sas6 PE=2 SV=1
9	Q6PH08	0.35	37.7	957	0.036	0.045	ERC2_MOUSE ERC protein 2 OS=Mus musculus OX=10090 GN=Erc2 PE=1 SV=2
10	Q21443	0.45	37.0	566	0.021	0.044	LMN1_CAEEL Lamin-1 OS=Caenorhabditis elegans OX=6239 GN=lmn-1 PE=1 SV=2
11	Q8VDP4	0.46	37.4	922	0.021	0.027	CCAR2_MOUSE Cell cycle and apoptosis regulator protein 2 OS=Mus musculus OX=10090 GN=Ccar2 PE=1 SV=2
12	Q8VHG2	0.52	37.0	1126	0.030	0.032	AMOT_MOUSE Angiomotin OS=Mus musculus OX=10090 GN=Amot PE=1 SV=3
13	F1LUA1	0.53	37.0	1450	0.026	0.021	F1LUA1_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=2
14	A0A8I6AIN6	0.58	37.0	1453	0.026	0.021	A0A8I6AIN6_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=1
15	A0A8I6A8E0	0.64	37.0	1431	0.026	0.022	A0A8I6A8E0_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=1
16	I3L2J8	0.67	36.6	1047	0.052	0.059	I3L2J8_HUMAN Centrosomal protein 131 OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=1
17	A0A0G2K051	0.84	36.6	1407	0.026	0.022	A0A0G2K051_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=2
18	A0A8I5ZV67	0.85	36.2	1411	0.026	0.022	A0A8I5ZV67_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=4 SV=1
19	Q5VU43	0.93	36.2	2346	0.030	0.015	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
20	Q9UPN4	1.0	36.2	1083	0.052	0.057	CP131_HUMAN Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14662 KASH_CCD	4.3e+02	12.2	Coiled-coil region of CCDC155 or KASH
2	PF01192 RNA_pol_Rpb6	4.1e+02	12.3	RNA polymerase Rpb6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000475489

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256442	0.745	G2/mitotic-specific cyclin-B1
2	9606.ENSP00000311984	0.724	ATP-dependent (S)-NAD(P)H-hydrate dehydratase
3	9606.ENSP00000272321	0.701	WD repeat-containing and planar cell polarity effector protein fritz homolog
4	9606.ENSP00000305653	0.676	Mitochondrial proton/calcium exchanger protein
5	9606.ENSP00000409906	0.603	Inactive ubiquitin carboxyl-terminal hydrolase 53
6	9606.ENSP00000307674	0.596	Soluble calcium-activated nucleotidase 1
7	9606.ENSP00000347931	0.578	Pecanex-like 3 (Drosophila)
8	9606.ENSP00000261692	0.573	Cyclin-dependent kinase 2-associated protein 1
9	9606.ENSP00000264977	0.569	Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha
10	9606.ENSP00000261749	0.519	AN1-type zinc finger protein 6
11	9606.ENSP00000367564	0.515	UPF0692 protein C19orf54
12	9606.ENSP00000433427	0.509	ADP-ribosylation factor-like protein 15
13	9606.ENSP00000370671	0.508	Kelch-like protein 42

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0048523	0.861	negative regulation of cellular process
GO:0051128	0.843	regulation of cellular component organization
GO:0033043	0.823	regulation of organelle organization
GO:1902116	0.810	negative regulation of organelle assembly
GO:0120033	0.672	negative regulation of plasma membrane bounded cell projection assembly
GO:1902017	0.661	regulation of cilium assembly
GO:0009987	0.647	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	0.999	centrosome
GO:0005737	0.997	cytoplasm
GO:0016020	0.996	membrane
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0005829	0.808	cytosol
GO:0005634	0.743	nucleus
GO:0005794	0.740	Golgi apparatus
GO:0043233	0.541	organelle lumen
GO:0070013	0.498	intracellular organelle lumen
GO:0005814	0.454	centriole
GO:0031981	0.442	nuclear lumen
GO:0005654	0.386	nucleoplasm
GO:0071944	0.346	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]