StarFunc result for job id Q99551

User Input

>input (399 residues)
MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGV
KCHNTDSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEV
IASIISRYPRAITRTPENLSKRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNI
KFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPADFVRKIIFK
NPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAEILDLSNDYARRSYANIKEKL
FSLGCTEEEVQKFVLSYPDVIFLAEKKFNDKIDCLMEENISISQIIENPRVLDSSISTLK
SRIKELVNAGCNLSTLNITLLSWSKKRYEAKLKKLSRFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99551	1.000	1.000	8.418E-51	399	1.000	1.000	Q99551.pdb.gz	MTEF1_HUMAN Transcription termination factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF1 PE=1 SV=1
2	AFDB:B9EJ57	0.827	0.871	6.914E-38	379	0.714	0.752	B9EJ57.pdb.gz	MTF1B_MOUSE Transcription termination factor 1b, mitochondrial OS=Mus musculus OX=10090 GN=Mterf1b PE=2 SV=1
3	AFDB:Q49AM1	0.678	0.699	9.635E-19	385	0.246	0.255	Q49AM1.pdb.gz	MTEF2_HUMAN Transcription termination factor 2, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF2 PE=1 SV=2
4	AFDB:Q8BKY8	0.636	0.655	4.743E-18	385	0.236	0.244	Q8BKY8.pdb.gz	MTEF2_MOUSE Transcription termination factor 2, mitochondrial OS=Mus musculus OX=10090 GN=Mterf2 PE=1 SV=1
5	AFDB:Q9FM80	0.575	0.476	3.994E-9	496	0.168	0.135	Q9FM80.pdb.gz	MTEF9_ARATH Transcription termination factor MTERF9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF9 PE=2 SV=1
6	AFDB:Q9ZT96	0.532	0.407	5.826E-9	541	0.213	0.157	Q9ZT96.pdb.gz	MTEF4_ARATH Transcription termination factor MTERF4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF4 PE=1 SV=1
7	AFDB:Q8R3J4	0.488	0.474	1.140E-8	412	0.175	0.170	Q8R3J4.pdb.gz	MTEF3_MOUSE Transcription termination factor 3, mitochondrial OS=Mus musculus OX=10090 GN=Mterf3 PE=2 SV=1
8	AFDB:Q3ED83	0.632	0.644	2.138E-8	390	0.150	0.154	Q3ED83.pdb.gz	Q3ED83_ARATH Mitochondrial transcription termination factor family protein OS=Arabidopsis thaliana OX=3702 GN=MTERF27 PE=1 SV=1
9	AFDB:Q96E29	0.453	0.436	2.325E-8	417	0.170	0.163	Q96E29.pdb.gz	MTEF3_HUMAN Transcription termination factor 3, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF3 PE=1 SV=2
10	AFDB:Q9VPD5	0.467	0.517	6.920E-8	354	0.145	0.164	Q9VPD5.pdb.gz	MTEF3_DROME Transcription termination factor 3, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mTerf3 PE=2 SV=1
11	PDB:7pd3y	0.339	0.519	1.422E-3	245	0.110	0.180	7pd3y.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
12	PDB:4cj9A	0.369	0.233	3.746E-2	752	0.123	0.065	4cj9A.pdb.gz
13	PDB:4axzA	0.086	0.124	9.465E-1	218	0.083	0.151	4axzA.pdb.gz
14	PDB:1kw2A	0.113	0.104	1.703	455	0.128	0.112	1kw2A.pdb.gz
15	PDB:6gzhB	0.147	0.199	1.852	252	0.093	0.147	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
16	PDB:7p5jA	0.101	0.101	2.284	399	0.125	0.125	7p5jA.pdb.gz
17	PDB:2y8pA	0.100	0.173	2.701	190	0.040	0.084	2y8pA.pdb.gz
18	PDB:5iztA	0.117	0.188	2.937	211	0.085	0.161	5iztA.pdb.gz
19	PDB:7z8fe	0.115	0.018	3.474	4579	0.110	0.010	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
20	PDB:4alyA	0.100	0.162	3.622	211	0.070	0.133	4alyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DPR9	0.0	772	379	0.950	1.000	B4DPR9_HUMAN Mitochondrial transcription termination factor 1 OS=Homo sapiens OX=9606 GN=MTERF1 PE=1 SV=1
2	B9EJ57	0.0	562	379	0.714	0.752	MTF1B_MOUSE Transcription termination factor 1b, mitochondrial OS=Mus musculus OX=10090 GN=Mterf1b PE=2 SV=1
3	Q8CHZ9	0.0	558	379	0.712	0.749	MTF1A_MOUSE Transcription termination factor 1a, mitochondrial OS=Mus musculus OX=10090 GN=Mterf1a PE=2 SV=1
4	Q99551	0.0	811	399	1.000	1.000	MTEF1_HUMAN Transcription termination factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF1 PE=1 SV=1
5	C9JE25	2.83e-114	332	158	0.396	1.000	C9JE25_HUMAN Mitochondrial transcription termination factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=MTERF1 PE=1 SV=1
6	C9JNM8	8.38e-100	294	139	0.348	1.000	C9JNM8_HUMAN Mitochondrial transcription termination factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=MTERF1 PE=1 SV=1
7	Q49AM1	7.00e-39	145	385	0.246	0.255	MTEF2_HUMAN Transcription termination factor 2, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF2 PE=1 SV=2
8	Q8BKY8	1.68e-37	141	385	0.243	0.252	MTEF2_MOUSE Transcription termination factor 2, mitochondrial OS=Mus musculus OX=10090 GN=Mterf2 PE=1 SV=1
9	Q9VPD5	1.55e-06	52.0	354	0.118	0.133	MTEF3_DROME Transcription termination factor 3, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mTerf3 PE=2 SV=1
10	Q9V3F3	4.72e-04	44.3	410	0.070	0.068	MTTF_DROME Transcription termination factor, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mTTF PE=2 SV=1
11	F4JSY9	0.024	38.9	378	0.135	0.143	F4JSY9_ARATH Mitochondrial transcription termination factor family protein OS=Arabidopsis thaliana OX=3702 GN=PDE191 PE=1 SV=1
12	Q8R3J4	0.031	38.9	412	0.123	0.119	MTEF3_MOUSE Transcription termination factor 3, mitochondrial OS=Mus musculus OX=10090 GN=Mterf3 PE=2 SV=1
13	Q9SZL6	0.034	38.5	333	0.133	0.159	MTEF6_ARATH Transcription termination factor MTERF6, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTERF6 PE=2 SV=1
14	Q96E29	0.14	36.6	417	0.120	0.115	MTEF3_HUMAN Transcription termination factor 3, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF3 PE=1 SV=2
15	F4JVI3	0.23	36.2	493	0.103	0.083	MTEF5_ARATH Transcription termination factor MTERF5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF5 PE=1 SV=1
16	A0A494C1N2	0.54	35.0	1013	0.055	0.022	A0A494C1N2_HUMAN Caspase recruitment domain family member 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=1
17	Q9BXL6	0.55	35.0	1004	0.055	0.022	CAR14_HUMAN Caspase recruitment domain-containing protein 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=2
18	F4IHL3	0.83	34.3	641	0.080	0.050	MTEF2_ARATH Transcription termination factor MTERF2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF2 PE=3 SV=1
19	Q9FM80	0.94	34.3	496	0.140	0.113	MTEF9_ARATH Transcription termination factor MTERF9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF9 PE=2 SV=1
20	P28793	1.0	34.3	715	0.035	0.020	FADB_PSEFR Fatty acid oxidation complex subunit alpha OS=Pseudomonas fragi OX=296 GN=fadB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09664 DUF2399	5.9e+02	11.7	Protein of unknown function C-terminus (DUF2399)
2	PF13475 DUF4116	1.3e+02	13.7	Domain of unknown function (DUF4116)
3	PF16902 FokI_D3	5.7e+02	12.0	FokI, D3 domain
4	PF02536 mTERF	4.4e-82	287.2	mTERF

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000248643

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220429	0.917	GA-binding protein subunit beta-1
2	9606.ENSP00000369383	0.911	Protein Mpv17
3	9606.ENSP00000346886	0.900	GA-binding protein alpha chain
4	9606.ENSP00000287025	0.863	Transcription termination factor 3, mitochondrial
5	9606.ENSP00000355471	0.825	Dimethyladenosine transferase 2, mitochondrial
6	9606.ENSP00000465759	0.818	DNA-directed RNA polymerase, mitochondrial
7	9606.ENSP00000480378	0.817	Transcription termination factor 4, mitochondrial
8	9606.ENSP00000356134	0.761	Dimethyladenosine transferase 1, mitochondrial
9	9606.ENSP00000420588	0.755	Transcription factor A, mitochondrial
10	9606.ENSP00000419740	0.754	5-methylcytosine rRNA methyltransferase NSUN4
11	9606.ENSP00000366939	0.748	Mitochondrial genome maintenance exonuclease 1
12	9606.ENSP00000348573	0.725	A-kinase anchor protein 9
13	9606.ENSP00000462963	0.703	Transcription elongation factor, mitochondrial
14	9606.ENSP00000312599	0.702	Transmembrane protein 70, mitochondrial
15	9606.ENSP00000364883	0.686	Methylglutaconyl-CoA hydratase, mitochondrial
16	9606.ENSP00000332340	0.664	Probable ATP-dependent RNA helicase DDX28
17	9606.ENSP00000354499	0.662	Cytochrome c oxidase subunit 1
18	9606.ENSP00000333920	0.644	Transcription termination factor 1
19	9606.ENSP00000236980	0.639	FAST kinase domain-containing protein 2, mitochondrial
20	9606.ENSP00000405620	0.639	Putative ATP-dependent RNA helicase DHX30

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.996	RNA binding
GO:0003690	0.995	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0010467	0.987	gene expression
GO:0016070	0.987	RNA metabolic process
GO:0000959	0.976	mitochondrial RNA metabolic process
GO:0140053	0.972	mitochondrial gene expression
GO:0006351	0.970	DNA-templated transcription
GO:0071840	0.866	cellular component organization or biogenesis
GO:0006996	0.852	organelle organization
GO:0071103	0.340	DNA conformation change
GO:0032392	0.313	DNA geometric change

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.973	intracellular organelle lumen
GO:0043232	0.731	intracellular non-membrane-bounded organelle
GO:0009295	0.380	nucleoid
GO:0005759	0.363	mitochondrial matrix
GO:0042645	0.322	mitochondrial nucleoid

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]