StarFunc result for job id Q99569

User Input

>input (1192 residues)
MPAPEQASLVEEGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQ
IVASQLERCRLGAESPSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQPNNYLIRTEP
EQGTLYSPEQTSLHESEGSLGNSRSSTQMNSYSDSGYQEAGSFHNSQNVSKADNRQQHSF
IGSTNNHVVRNSRAEGQTLVQPSVANRAMRRVSSVPSRAQSPSYVISTGVSPSRGSLRTS
LGSGFGSPSVTDPRPLNPSAYSSTTLPAARAASPYSQRPASPTAIRRIGSVTSRQTSNPN
GPTPQYQTTARVGSPLTLTDAQTRVASPSQGQVGSSSPKRSGMTAVPQHLGPSLQRTVHD
MEQFGQQQYDIYERMVPPRPDSLTGLRSSYASQHSQLGQDLRSAVSPDLHITPIYEGRTY
YSPVYRSPNHGTVELQGSQTALYRTGSVGIGNLQRTSSQRSTLTYQRNNYALNTTATYAE
PYRPIQYRVQECNYNRLQHAVPADDGTTRSPSIDSIQKDPREFAWRDPELPEVIHMLQHQ
FPSVQANAAAYLQHLCFGDNKVKMEVCRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFG
KSTDENKIAMKNVGGIPALLRLLRKSIDAEVRELVTGVLWNLSSCDAVKMTIIRDALSTL
TNTVIVPHSGWNNSSFDDDHKIKFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDS
LLYVIHTCVNTSDYDSKTVENCVCTLRNLSYRLELEVPQARLLGLNELDDLLGKESPSKD
SEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEMLWHPSVVKPYLTLLAESSNP
ATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMA
LDVRNKELIGKYAMRDLVNRLPGGNGPSVLSDETMAAICCALHEVTSKNMENAKALADSG
GIEKLVNITKGRGDRSSLKVVKAAAQVLNTLWQYRDLRSIYKKDGWNQNHFITPVSTLER
DRFKSHPSLSTTNQQMSPIIQSVGSTSSSPALLGIRDPRSEYDRTQPPMQYYNSQGDATH
KGLYPGSSKPSPIYISSYSSPAREQNRRLQHQQLYYSQDDSNRKNFDAYRLYLQSPHSYE
DPYFDDRVHFPASTDYSTQYGLKSTTNYVDFYSTKRPSYRAEQYPGSPDSWV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99569	1.000	1.000	0.000	1192	1.000	1.000	Q99569.pdb.gz	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
2	AFDB:Q9UQB3	0.506	0.494	6.281E-65	1225	0.510	0.496	Q9UQB3.pdb.gz	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
3	AFDB:O35927	0.463	0.444	3.392E-63	1247	0.508	0.486	O35927.pdb.gz	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
4	AFDB:A1L266	0.227	0.334	2.278E-36	794	0.316	0.475	A1L266.pdb.gz
5	PDB:2z6gA	0.232	0.438	3.187E-10	550	0.078	0.169	2z6gA.pdb.gz
6	PDB:7rroH7	0.148	0.257	9.085E-10	580	0.081	0.167	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
7	PDB:4r0zA	0.205	0.382	1.954E-9	557	0.068	0.145	4r0zA.pdb.gz
8	PDB:6kbnC	0.279	0.616	2.105E-8	504	0.073	0.173	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
9	PDB:5tbkA	0.265	0.697	3.701E-8	417	0.065	0.185	5tbkA.pdb.gz
10	PDB:1wa5B	0.249	0.574	6.002E-8	466	0.065	0.165	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
11	PDB:4tnmA	0.269	0.716	6.506E-8	407	0.071	0.209	4tnmA.pdb.gz
12	AFDB:Q7Z5K2	0.206	0.207	6.453E-7	1190	0.116	0.116	Q7Z5K2.pdb.gz	WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1
13	AFDB:Q5H9R4	0.183	0.100	6.994E-7	2290	0.092	0.048	Q5H9R4.pdb.gz	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
14	PDB:3tpoA	0.276	0.684	7.299E-7	438	0.067	0.183	3tpoA.pdb.gz
15	AFDB:Q86US8	0.098	0.087	7.893E-7	1419	0.138	0.116	Q86US8.pdb.gz	EST1A_HUMAN Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6 PE=1 SV=2
16	PDB:7nscE	0.206	0.329	8.929E-7	615	0.065	0.125	7nscE.pdb.gz
17	AFDB:Q57WC1	0.071	0.064	1.230E-6	1387	0.156	0.134	Q57WC1.pdb.gz	Q57WC1_TRYB2 Ancestral coatomer element 1 Sec16/Sec31 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.610 PE=3 SV=1
18	AFDB:A0A0R4IZ84	0.091	0.079	1.273E-5	1544	0.111	0.085	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
19	PDB:7anwA	0.145	0.243	1.328E-5	645	0.060	0.110	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
20	AFDB:B0M0P8	0.102	0.061	1.757E-5	2356	0.117	0.059	B0M0P8.pdb.gz	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0V2S9	0.0	1024	1210	0.511	0.503	B0V2S9_DANRE Catenin (cadherin-associated protein), delta 2b OS=Danio rerio OX=7955 GN=ctnnd2 PE=1 SV=1
2	O35927	0.0	1030	1247	0.513	0.491	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
3	Q68FH0	0.0	2371	1190	0.965	0.966	PKP4_MOUSE Plakophilin-4 OS=Mus musculus OX=10090 GN=Pkp4 PE=1 SV=1
4	Q99569	0.0	2464	1192	1.000	1.000	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
5	Q9UQB3	0.0	1058	1225	0.518	0.504	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
6	O00192	1.17e-153	487	962	0.214	0.265	ARVC_HUMAN Splicing regulator ARVCF OS=Homo sapiens OX=9606 GN=ARVCF PE=1 SV=1
7	P98203	7.48e-152	482	962	0.210	0.260	ARVC_MOUSE Splicing regulator ARVCF OS=Mus musculus OX=10090 GN=Arvcf PE=1 SV=2
8	Q8T0H3	4.11e-148	459	562	0.214	0.454	Q8T0H3_DROME LD03740p OS=Drosophila melanogaster OX=7227 GN=p120ctn PE=2 SV=1
9	Q9NHP1	1.39e-147	465	781	0.214	0.327	Q9NHP1_DROME Arm repeat protein OS=Drosophila melanogaster OX=7227 GN=p120ctn PE=2 SV=1
10	Q7PLI0	2.10e-147	464	781	0.214	0.327	Q7PLI0_DROME Adherens junction protein p120 OS=Drosophila melanogaster OX=7227 GN=p120ctn PE=1 SV=1
11	P30999	2.87e-143	459	938	0.203	0.258	CTND1_MOUSE Catenin delta-1 OS=Mus musculus OX=10090 GN=Ctnnd1 PE=1 SV=2
12	D3ZZZ9	1.14e-142	456	892	0.202	0.270	D3ZZZ9_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=2
13	A0A0G2JXM1	2.44e-142	457	967	0.202	0.249	A0A0G2JXM1_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=1
14	A0A669KB05	5.80e-142	454	915	0.201	0.262	A0A669KB05_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
15	C9JZR2	1.83e-141	454	938	0.201	0.256	C9JZR2_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=2
16	O60716	2.09e-141	454	968	0.201	0.248	CTND1_HUMAN Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
17	A0A8I5ZVG2	7.25e-141	450	870	0.203	0.278	A0A8I5ZVG2_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=1
18	A0A669KB62	3.07e-140	449	888	0.202	0.271	A0A669KB62_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
19	F1R6C8	6.43e-137	441	908	0.195	0.256	F1R6C8_DANRE Catenin (cadherin-associated protein), delta 1 OS=Danio rerio OX=7955 GN=ctnnd1 PE=1 SV=2
20	A0A286Y8C1	8.87e-135	436	931	0.194	0.248	A0A286Y8C1_DANRE Catenin (cadherin-associated protein), delta 1 OS=Danio rerio OX=7955 GN=ctnnd1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	1.7e-42	153.4	Armadillo/beta-catenin-like repeat
2	PF02985 HEAT	1.2	20.6	HEAT repeat
3	PF13646 HEAT_2	0.017	26.8	HEAT repeats
4	PF13513 HEAT_EZ	1.4	20.8	HEAT-like repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374409

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000426632	0.992	Erbin
2	9606.ENSP00000369129	0.983	Desmoplakin
3	9606.ENSP00000285071	0.945	Folliculin
4	9606.ENSP00000326366	0.929	Presenilin-1
5	9606.ENSP00000402033	0.878	PDZ domain containing 2
6	9606.ENSP00000257189	0.866	Desmoglein-3
7	9606.ENSP00000377508	0.860	Junction plakoglobin
8	9606.ENSP00000261590	0.858	Desmoglein-2
9	9606.ENSP00000353608	0.853	Desmocollin-3
10	9606.ENSP00000344456	0.839	Catenin beta-1
11	9606.ENSP00000280904	0.829	Desmocollin-2
12	9606.ENSP00000257192	0.814	Desmoglein-1
13	9606.ENSP00000257198	0.811	Desmocollin-1
14	9606.ENSP00000352785	0.811	Desmoglein-4
15	9606.ENSP00000304669	0.788	Catenin alpha-1
16	9606.ENSP00000384638	0.772	Catenin alpha-2
17	9606.ENSP00000344115	0.770	Cadherin-5
18	9606.ENSP00000400175	0.769	Transforming protein RhoA
19	9606.ENSP00000363317	0.767	FERM and PDZ domain-containing protein 2
20	9606.ENSP00000376457	0.765	Protein ECT2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0034330	0.822	cell junction organization
GO:0048518	0.743	positive regulation of biological process
GO:0048522	0.691	positive regulation of cellular process
GO:0065009	0.639	regulation of molecular function
GO:0044085	0.638	cellular component biogenesis
GO:0045216	0.623	cell-cell junction organization
GO:0051302	0.616	regulation of cell division
GO:0032502	0.567	developmental process
GO:0048856	0.555	anatomical structure development
GO:0050896	0.509	response to stimulus
GO:0032501	0.441	multicellular organismal process
GO:0007155	0.429	cell adhesion
GO:0022607	0.418	cellular component assembly
GO:0044093	0.415	positive regulation of molecular function
GO:0034329	0.358	cell junction assembly
GO:0051726	0.340	regulation of cell cycle
GO:0007275	0.331	multicellular organism development
GO:0010646	0.322	regulation of cell communication
GO:0023051	0.312	regulation of signaling
GO:0007043	0.309	cell-cell junction assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.998	organelle
GO:0005622	0.998	intracellular anatomical structure
GO:0030054	0.997	cell junction
GO:0016020	0.992	membrane
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0071944	0.990	cell periphery
GO:0005737	0.989	cytoplasm
GO:0005886	0.980	plasma membrane
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0005829	0.951	cytosol
GO:0005634	0.926	nucleus
GO:0070161	0.877	anchoring junction
GO:0005856	0.862	cytoskeleton
GO:0005911	0.840	cell-cell junction
GO:0043233	0.477	organelle lumen
GO:0070013	0.472	intracellular organelle lumen
GO:0048471	0.368	perinuclear region of cytoplasm
GO:0009898	0.367	cytoplasmic side of plasma membrane
GO:0045202	0.363	synapse
GO:0031981	0.347	nuclear lumen
GO:0051233	0.345	spindle midzone
GO:0098794	0.341	postsynapse
GO:0044291	0.318	cell-cell contact zone
GO:0001533	0.304	cornified envelope
GO:0072686	0.301	mitotic spindle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]