StarFunc result for job id Q99570

User Input

>input (1358 residues)
MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDP
TLPLTSYKQELEELKIRLNSAQNCLPFQKASEKASEKAAMLFRQYVRDNLYDRISTRPFL
NNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNP
ADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRTRGELKRAMD
IFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDHSIRELVTQMIHREPDK
RLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGH
DLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITP
YLLHFSNDSVPRVRAEALRTLTKVLALVKEVPRNDINIYPEYILPGIAHLAQDDATIVRL
AYAENIALLAETALRFLELVQLKNLNMENDPNNEEIDEVTHPNGNYDTELQALHEMVQQK
VVTLLSDPENIVKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDS
IVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALYALTCMCQLGLLQKPHVYEFASDI
APFLCHPNLWIRYGAVGFITVVARQISTADVYCKLMPYLDPYITQPIIQIERKLVLLSVL
KEPVSRSIFDYALRSKDITSLFRHLHMRQKKRNGSLPDCPPPEDPAIAQLLKKLLSQGMT
EEEEDKLLALKDFMMKSNKAKANIVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEP
DDKRARKHVKQDSNVNEEWKSMFGSLDPPNMPQALPKGSDQEVIQTGKPPRSESSAGICV
PLSTSSQVPEVTTVQNKKPVIPVLSSTILPSTYQIRITTCKTELQQLIQQKREQCNAERI
AKQMMENAEWESKPPPPGWRPKGLLVAHLHEHKSAVNRIRVSDEHSLFATCSNDGTVKIW
NSQKMEGKTTTTRSILTYSRIGGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSP
KIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLK
SGLITSFAVDIHQCWLCIGTSSGTMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWV
IAAVQGNNEVSMWDMETGDRRFTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAG
SDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRG
PESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VD65	0.930	0.930	0.000	1358	0.958	0.958	Q8VD65.pdb.gz	PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus OX=10090 GN=Pik3r4 PE=1 SV=3
2	AFDB:Q9VHH2	0.585	0.591	0.000	1342	0.420	0.425	Q9VHH2.pdb.gz	Q9VHH2_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Vps15 PE=1 SV=1
3	PDB:7bl1CCC	0.430	0.476	2.879E-81	1189	0.853	0.975	7bl1CCC.pdb.gz	Structural basis for VPS34 kinase activation by Rab1 and Rab5 on membranes.
4	AFDB:Q9M0E5	0.484	0.442	3.579E-77	1494	0.328	0.299	Q9M0E5.pdb.gz	VPS15_ARATH Serine/threonine-protein kinase VPS15 OS=Arabidopsis thaliana OX=3702 GN=VPS15 PE=1 SV=1
5	AFDB:P22219	0.541	0.507	1.023E-69	1454	0.276	0.258	P22219.pdb.gz	VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS15 PE=1 SV=4
6	AFDB:O42900	0.514	0.414	2.517E-64	1706	0.293	0.233	O42900.pdb.gz	PPK19_SCHPO Serine/threonine-protein kinase ppk19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk19 PE=1 SV=1
7	AFDB:Q384A9	0.434	0.431	1.360E-47	1370	0.197	0.196	Q384A9.pdb.gz	Q384A9_TRYB2 non-specific serine/threonine protein kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0930 PE=4 SV=1
8	PDB:5dfzB	0.385	0.417	1.778E-29	1224	0.208	0.231	5dfzB.pdb.gz
9	AFDB:Q562E7	0.209	0.148	3.576E-17	1941	0.158	0.110	Q562E7.pdb.gz	WDR81_HUMAN WD repeat-containing protein 81 OS=Homo sapiens OX=9606 GN=WDR81 PE=1 SV=2
10	AFDB:Q9C9H8	0.183	0.247	1.764E-13	909	0.096	0.143	Q9C9H8.pdb.gz	SCY2B_ARATH SCY1-like protein 2 B OS=Arabidopsis thaliana OX=3702 GN=SCYL2B PE=1 SV=1
11	AFDB:G5EE12	0.206	0.398	6.943E-13	678	0.059	0.118	G5EE12.pdb.gz	G5EE12_CAEEL Striatin N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cash-1 PE=1 SV=1
12	AFDB:O48847	0.200	0.338	8.158E-13	787	0.066	0.113	O48847.pdb.gz	LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana OX=3702 GN=LUH PE=1 SV=1
13	PDB:6u62A	0.199	0.241	2.066E-12	1110	0.098	0.120	6u62A.pdb.gz	Structural basis for the docking of mTORC1 on the lysosomal surface.
14	PDB:5wbjA	0.202	0.254	9.557E-12	1058	0.110	0.142	5wbjA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
15	PDB:3jcmB	0.201	0.606	1.614E-11	429	0.040	0.126	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
16	PDB:7mq8LU	0.201	0.583	2.415E-11	445	0.045	0.137	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:6bcuW	0.192	0.244	2.618E-11	1052	0.091	0.117	6bcuW.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
18	PDB:2h9lA	0.198	0.773	3.202E-11	321	0.044	0.187	2h9lA.pdb.gz
19	PDB:7jvrB	0.202	0.736	4.988E-11	342	0.043	0.173	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
20	PDB:5mzhB	0.194	0.573	6.102E-11	415	0.052	0.169	5mzhB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KGX5	0.0	754	861	0.297	0.469	A0A0B4KGX5_DROME Vacuolar protein sorting 15, isoform C OS=Drosophila melanogaster OX=7227 GN=Vps15 PE=4 SV=1
2	E1JIG3	0.0	754	851	0.297	0.475	E1JIG3_DROME FI23917p1 OS=Drosophila melanogaster OX=7227 GN=Vps15 PE=2 SV=1
3	Q8VD65	0.0	2703	1358	0.959	0.959	PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus OX=10090 GN=Pik3r4 PE=1 SV=3
4	Q99570	0.0	2832	1358	1.000	1.000	PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PIK3R4 PE=1 SV=3
5	Q9VHH2	0.0	1024	1342	0.425	0.430	Q9VHH2_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Vps15 PE=1 SV=1
6	Q961J4	1.33e-172	536	815	0.230	0.383	Q961J4_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Vps15 PE=2 SV=1
7	P22219	8.87e-120	410	1454	0.197	0.184	VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS15 PE=1 SV=4
8	Q6FRH8	2.79e-106	370	1410	0.194	0.187	VPS15_CANGA non-specific serine/threonine protein kinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=VPS15 PE=3 SV=1
9	A0A1D8PPK3	5.63e-106	371	1537	0.194	0.171	A0A1D8PPK3_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VPS15 PE=4 SV=1
10	Q9M0E5	1.42e-79	291	1494	0.114	0.104	VPS15_ARATH Serine/threonine-protein kinase VPS15 OS=Arabidopsis thaliana OX=3702 GN=VPS15 PE=1 SV=1
11	O42900	1.01e-72	270	1706	0.108	0.086	PPK19_SCHPO Serine/threonine-protein kinase ppk19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk19 PE=1 SV=1
12	Q384A9	5.40e-38	158	1370	0.114	0.113	Q384A9_TRYB2 non-specific serine/threonine protein kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0930 PE=4 SV=1
13	Q9XF67	1.25e-09	64.7	491	0.056	0.155	PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=PDPK1 PE=1 SV=1
14	Q66HE5	6.85e-08	59.3	630	0.032	0.070	NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus OX=10116 GN=Nuak2 PE=1 SV=1
15	Q03407	1.35e-07	58.5	766	0.038	0.068	PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PKH1 PE=1 SV=1
16	Q5I6E8	2.17e-07	57.8	494	0.052	0.144	Q5I6E8_SOLLC non-specific serine/threonine protein kinase OS=Solanum lycopersicum OX=4081 GN=Pdk1 PE=1 SV=1
17	Q4V3C8	2.86e-07	57.4	486	0.053	0.148	PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PDPK2 PE=1 SV=1
18	G5EFD2	3.83e-07	57.0	771	0.047	0.083	KSRA_CAEEL Kinase suppressor of Ras A OS=Caenorhabditis elegans OX=6239 GN=ksr-1 PE=1 SV=1
19	Q9URT9	8.96e-07	55.1	381	0.052	0.184	GSK31_SCHPO Protein kinase gsk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gsk31 PE=1 SV=1
20	O60285	1.49e-06	55.1	661	0.031	0.064	NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens OX=9606 GN=NUAK1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	2.3	19.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF02985 HEAT	4e-05	34.5	HEAT repeat
3	PF13646 HEAT_2	63	15.4	HEAT repeats
4	PF13513 HEAT_EZ	3.8e+02	13.1	HEAT-like repeat
5	PF05004 IFRD	81	13.7	Interferon-related developmental regulator (IFRD)
6	PF20426 NBCH_WD40	0.14	22.6	Neurobeachin beta propeller domain
7	PF00069 Pkinase	1.1e-14	66.0	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	0.045	24.6	Protein tyrosine and serine/threonine kinase
9	PF19974 TCAD9	62	14.1	Ternary complex associated domain 9
10	PF00400 WD40	4.5e-09	48.0	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349205

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247178	0.999	Beclin 1-associated autophagy-related key regulator
2	9606.ENSP00000262039	0.999	Phosphatidylinositol 3-kinase catalytic subunit type 3
3	9606.ENSP00000348455	0.999	UV radiation resistance-associated gene protein
4	9606.ENSP00000355231	0.999	Beclin-1
5	9606.ENSP00000431926	0.994	Activating molecule in BECN1-regulated autophagy protein 1
6	9606.ENSP00000277746	0.992	Nuclear receptor-binding factor 2
7	9606.ENSP00000432412	0.992	Autophagy-related protein 13
8	9606.ENSP00000025008	0.990	RB1-inducible coiled-coil protein 1
9	9606.ENSP00000273047	0.990	Ras-related protein Rab-5A
10	9606.ENSP00000338990	0.990	Autophagy-related protein 101
11	9606.ENSP00000324560	0.985	Serine/threonine-protein kinase ULK1
12	9606.ENSP00000037243	0.983	Gamma-aminobutyric acid receptor-associated protein-like 2
13	9606.ENSP00000266458	0.983	Gamma-aminobutyric acid receptor-associated protein-like 1
14	9606.ENSP00000264380	0.981	1-phosphatidylinositol 3-phosphate 5-kinase
15	9606.ENSP00000386710	0.980	Autophagy-related protein 9A
16	9606.ENSP00000306866	0.976	Gamma-aminobutyric acid receptor-associated protein
17	9606.ENSP00000425107	0.972	Ubiquitin-like protein ATG12
18	9606.ENSP00000358072	0.966	Autophagy protein 5
19	9606.ENSP00000363970	0.965	Microtubule-associated proteins 1A/1B light chain 3A
20	9606.ENSP00000283290	0.964	Ubiquitin-like-conjugating enzyme ATG3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0140096	0.541	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0008152	0.972	metabolic process
GO:0050789	0.972	regulation of biological process
GO:0051716	0.939	cellular response to stimulus
GO:0044237	0.925	cellular metabolic process
GO:0050794	0.912	regulation of cellular process
GO:0007154	0.898	cell communication
GO:0019222	0.864	regulation of metabolic process
GO:0071704	0.676	organic substance metabolic process
GO:0044238	0.674	primary metabolic process
GO:0016236	0.642	macroautophagy
GO:0048518	0.636	positive regulation of biological process
GO:0006807	0.612	nitrogen compound metabolic process
GO:0031323	0.594	regulation of cellular metabolic process
GO:0043170	0.569	macromolecule metabolic process
GO:0006950	0.559	response to stress
GO:1901564	0.558	organonitrogen compound metabolic process
GO:0048522	0.557	positive regulation of cellular process
GO:0019538	0.554	protein metabolic process
GO:0071840	0.513	cellular component organization or biogenesis
GO:0009605	0.472	response to external stimulus
GO:0016043	0.472	cellular component organization
GO:0051179	0.460	localization
GO:0080090	0.418	regulation of primary metabolic process
GO:0036211	0.418	protein modification process
GO:0009893	0.399	positive regulation of metabolic process
GO:0051641	0.393	cellular localization
GO:0006796	0.378	phosphate-containing compound metabolic process
GO:0060255	0.368	regulation of macromolecule metabolic process
GO:0051234	0.345	establishment of localization
GO:0033554	0.326	cellular response to stress
GO:0006996	0.318	organelle organization
GO:0009894	0.313	regulation of catabolic process
GO:0016310	0.311	phosphorylation
GO:0031669	0.309	cellular response to nutrient levels

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.999	endomembrane system
GO:0005942	0.999	phosphatidylinositol 3-kinase complex
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0035032	0.993	phosphatidylinositol 3-kinase complex, class III
GO:0005829	0.990	cytosol
GO:0031090	0.986	organelle membrane
GO:0043228	0.979	non-membrane-bounded organelle
GO:0043232	0.974	intracellular non-membrane-bounded organelle
GO:0098588	0.962	bounding membrane of organelle
GO:0031982	0.960	vesicle
GO:0031410	0.954	cytoplasmic vesicle
GO:0005768	0.918	endosome
GO:0005856	0.785	cytoskeleton
GO:0030659	0.579	cytoplasmic vesicle membrane
GO:0015630	0.544	microtubule cytoskeleton
GO:0005770	0.486	late endosome
GO:0030139	0.449	endocytic vesicle
GO:0042995	0.408	cell projection
GO:0120025	0.393	plasma membrane bounded cell projection
GO:0030670	0.334	phagocytic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]