StarFunc result for job id Q99572

User Input

>input (595 residues)
MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISS
VHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP
EYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPA
LLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGD
NFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYK
ENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSS
NCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRS
LQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCG
SCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDS
TNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99572	1.000	1.000	0.000	595	1.000	1.000	Q99572.pdb.gz	P2RX7_HUMAN P2X purinoceptor 7 OS=Homo sapiens OX=9606 GN=P2RX7 PE=1 SV=4
2	AFDB:Q9Z1M0	0.971	0.971	0.000	595	0.808	0.808	Q9Z1M0.pdb.gz	P2RX7_MOUSE P2X purinoceptor 7 OS=Mus musculus OX=10090 GN=P2rx7 PE=1 SV=2
3	AFDB:Q64663	0.788	0.788	8.475E-102	595	0.803	0.803	Q64663.pdb.gz	P2RX7_RAT P2X purinoceptor 7 OS=Rattus norvegicus OX=10116 GN=P2rx7 PE=1 SV=1
4	PDB:6u9wA	0.871	0.919	2.030E-92	562	0.761	0.806	6u9wA.pdb.gz	Full-Length P2X7Structures Reveal How Palmitoylation Prevents Channel Desensitization.
5	AFDB:A0A2R8QGJ4	0.814	0.811	3.158E-69	597	0.437	0.436	A0A2R8QGJ4.pdb.gz
6	AFDB:Q7SZL7	0.579	0.843	3.730E-47	401	0.287	0.426	Q7SZL7.pdb.gz
7	AFDB:Q99571	0.578	0.873	4.941E-47	388	0.284	0.436	Q99571.pdb.gz	P2RX4_HUMAN P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX4 PE=1 SV=2
8	AFDB:A0A2R8Q1T6	0.575	0.846	6.924E-47	398	0.279	0.417	A0A2R8Q1T6.pdb.gz
9	AFDB:P51577	0.579	0.875	1.609E-46	388	0.274	0.420	P51577.pdb.gz	P2RX4_RAT P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2rx4 PE=1 SV=1
10	AFDB:P51575	0.571	0.841	7.360E-45	399	0.271	0.404	P51575.pdb.gz	P2RX1_HUMAN P2X purinoceptor 1 OS=Homo sapiens OX=9606 GN=P2RX1 PE=1 SV=1
11	AFDB:P47824	0.571	0.840	8.256E-44	399	0.259	0.386	P47824.pdb.gz	P2RX1_RAT P2X purinoceptor 1 OS=Rattus norvegicus OX=10116 GN=P2rx1 PE=2 SV=1
12	PDB:3h9vA	0.503	0.886	4.057E-39	329	0.262	0.474	3h9vA.pdb.gz
13	PDB:5svkA	0.532	0.863	8.446E-38	357	0.247	0.412	5svkA.pdb.gz	X-ray structures define human P2X3 receptor gating cycle and antagonist action.
14	PDB:7jncA	0.095	0.152	2.672E-3	287	0.061	0.125	7jncA.pdb.gz
15	PDB:6rulA	0.057	0.093	1.713E-1	276	0.042	0.091	6rulA.pdb.gz	Chemogenetic Control of Nanobodies.
16	PDB:5z10A	0.100	0.052	2.144E-1	1304	0.045	0.021	5z10A.pdb.gz
17	PDB:7wltA	0.088	0.050	2.685E-1	1353	0.057	0.025	7wltA.pdb.gz	Structure deformation and curvature sensing of PIEZO1 in lipid membranes.
18	PDB:5a50A	0.068	0.166	4.210E-1	165	0.029	0.103	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:1lgbA	0.052	0.112	4.711E-1	181	0.025	0.083	1lgbA.pdb.gz	Structures of a legume lectin complexed with the human lactotransferrin N2 fragment, and with an isolated biantennary glycopeptide: role of the fucose moiety.
20	PDB:4aq5E	0.058	0.082	4.711E-1	370	0.045	0.073	4aq5E.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q64663	0.0	982	595	0.803	0.803	P2RX7_RAT P2X purinoceptor 7 OS=Rattus norvegicus OX=10116 GN=P2rx7 PE=1 SV=1
2	Q99572	0.0	1241	595	1.000	1.000	P2RX7_HUMAN P2X purinoceptor 7 OS=Homo sapiens OX=9606 GN=P2RX7 PE=1 SV=4
3	Q9Z1M0	0.0	967	595	0.808	0.808	P2RX7_MOUSE P2X purinoceptor 7 OS=Mus musculus OX=10090 GN=P2rx7 PE=1 SV=2
4	Q7SZM2	2.81e-157	465	596	0.435	0.435	Q7SZM2_DANRE P2X purinoceptor OS=Danio rerio OX=7955 GN=p2xr7 PE=2 SV=1
5	Q99571	1.66e-110	338	388	0.289	0.443	P2RX4_HUMAN P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX4 PE=1 SV=2
6	Q9JJX6	1.66e-107	330	388	0.282	0.433	P2RX4_MOUSE P2X purinoceptor 4 OS=Mus musculus OX=10090 GN=P2rx4 PE=1 SV=1
7	P51577	3.68e-106	327	388	0.279	0.428	P2RX4_RAT P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2rx4 PE=1 SV=1
8	B7Z6W8	3.30e-105	323	358	0.274	0.455	B7Z6W8_HUMAN P2X purinoceptor OS=Homo sapiens OX=9606 PE=2 SV=1
9	Q98TZ0	7.73e-105	323	389	0.277	0.424	Q98TZ0_DANRE P2X purinoceptor OS=Danio rerio OX=7955 GN=p2rx4 PE=2 SV=1
10	Q6NYR1	1.19e-104	323	389	0.277	0.424	Q6NYR1_DANRE P2X purinoceptor OS=Danio rerio OX=7955 GN=p2rx4a PE=1 SV=1
11	F8W463	2.75e-104	322	389	0.276	0.422	F8W463_DANRE P2X purinoceptor OS=Danio rerio OX=7955 GN=p2rx4a PE=1 SV=1
12	B3DHI3	6.93e-101	313	394	0.297	0.449	B3DHI3_DANRE P2X purinoceptor OS=Danio rerio OX=7955 GN=p2xr4.2 PE=2 SV=1
13	P51575	1.49e-90	286	399	0.254	0.378	P2RX1_HUMAN P2X purinoceptor 1 OS=Homo sapiens OX=9606 GN=P2RX1 PE=1 SV=1
14	P51576	2.68e-86	276	399	0.244	0.363	P2RX1_MOUSE P2X purinoceptor 1 OS=Mus musculus OX=10090 GN=P2rx1 PE=2 SV=1
15	P47824	1.22e-85	274	399	0.244	0.363	P2RX1_RAT P2X purinoceptor 1 OS=Rattus norvegicus OX=10116 GN=P2rx1 PE=2 SV=1
16	Q7SZM0	2.95e-80	260	398	0.242	0.362	Q7SZM0_DANRE P2X purinoceptor OS=Danio rerio OX=7955 GN=p2xr1 PE=2 SV=1
17	P56373	8.82e-80	259	397	0.254	0.380	P2RX3_HUMAN P2X purinoceptor 3 OS=Homo sapiens OX=9606 GN=P2RX3 PE=1 SV=2
18	Q3UR32	1.20e-78	256	397	0.250	0.375	P2RX3_MOUSE P2X purinoceptor 3 OS=Mus musculus OX=10090 GN=P2rx3 PE=2 SV=1
19	P49654	2.66e-78	255	397	0.250	0.375	P2RX3_RAT P2X purinoceptor 3 OS=Rattus norvegicus OX=10116 GN=P2rx3 PE=1 SV=1
20	P51579	7.02e-72	238	389	0.230	0.352	P2RX6_RAT P2X purinoceptor 6 OS=Rattus norvegicus OX=10116 GN=P2rx6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04579 Keratin_matx	0.66	21.7	Keratin, high-sulphur matrix protein
2	PF20478 P2RX7_C	2.5e-74	260.9	P2X purinoreceptor 7 intracellular domain
3	PF00864 P2X_receptor	2.6e-152	518.7	ATP P2X receptor
4	PF00673 Ribosomal_L5_C	2.3e+02	13.4	ribosomal L5P family C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330696

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227638	0.996	Pannexin-1
2	9606.ENSP00000296435	0.929	Cathelicidin antimicrobial peptide
3	9606.ENSP00000337383	0.918	NACHT, LRR and PYD domains-containing protein 3
4	9606.ENSP00000353032	0.860	P2X purinoceptor 4
5	9606.ENSP00000225328	0.857	P2X purinoceptor 5
6	9606.ENSP00000225538	0.853	P2X purinoceptor 1
7	9606.ENSP00000416193	0.834	P2X purinoceptor 6
8	9606.ENSP00000360608	0.826	Glutamate receptor ionotropic, NMDA 1
9	9606.ENSP00000263314	0.822	P2X purinoceptor 3
10	9606.ENSP00000379818	0.820	Glutamate receptor ionotropic, NMDA 2A
11	9606.ENSP00000310305	0.815	P2Y purinoceptor 2
12	9606.ENSP00000263269	0.806	Glutamate receptor ionotropic, NMDA 2D
13	9606.ENSP00000293190	0.806	Glutamate receptor ionotropic, NMDA 2C
14	9606.ENSP00000433138	0.803	Caspase-1
15	9606.ENSP00000304767	0.792	P2Y purinoceptor 1
16	9606.ENSP00000480966	0.783	P2Y purinoceptor 6
17	9606.ENSP00000302079	0.762	C3a anaphylatoxin chemotactic receptor
18	9606.ENSP00000263341	0.760	Interleukin-1 beta
19	9606.ENSP00000363643	0.760	P2Y purinoceptor 4
20	9606.ENSP00000260010	0.745	Toll-like receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001614	1.000	purinergic nucleotide receptor activity
GO:0005524	1.000	ATP binding
GO:0004931	1.000	extracellularly ATP-gated monoatomic cation channel activity
GO:0042802	0.890	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0009987	0.991	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0051716	0.983	cellular response to stimulus
GO:0006810	0.948	transport
GO:0007154	0.944	cell communication
GO:0042221	0.936	response to chemical
GO:0023052	0.935	signaling
GO:0071702	0.918	organic substance transport
GO:0010033	0.877	response to organic substance
GO:0007165	0.866	signal transduction
GO:1901700	0.844	response to oxygen-containing compound
GO:0048518	0.761	positive regulation of biological process
GO:0019222	0.653	regulation of metabolic process
GO:1901698	0.625	response to nitrogen compound
GO:0065008	0.594	regulation of biological quality
GO:0070887	0.594	cellular response to chemical stimulus
GO:0014070	0.587	response to organic cyclic compound
GO:0048522	0.585	positive regulation of cellular process
GO:0051049	0.562	regulation of transport
GO:0010243	0.557	response to organonitrogen compound
GO:0060255	0.528	regulation of macromolecule metabolic process
GO:0051239	0.479	regulation of multicellular organismal process
GO:0080090	0.447	regulation of primary metabolic process
GO:0014074	0.441	response to purine-containing compound
GO:0006812	0.428	monoatomic cation transport
GO:0032501	0.425	multicellular organismal process
GO:0033198	0.411	response to ATP
GO:0006816	0.386	calcium ion transport
GO:0009893	0.384	positive regulation of metabolic process
GO:0048583	0.377	regulation of response to stimulus
GO:0051171	0.374	regulation of nitrogen compound metabolic process
GO:0071840	0.371	cellular component organization or biogenesis
GO:0010604	0.369	positive regulation of macromolecule metabolic process
GO:0051240	0.363	positive regulation of multicellular organismal process
GO:0001817	0.363	regulation of cytokine production
GO:0006950	0.352	response to stress
GO:0031323	0.351	regulation of cellular metabolic process
GO:0023051	0.338	regulation of signaling
GO:0001819	0.336	positive regulation of cytokine production
GO:0010646	0.335	regulation of cell communication
GO:0002376	0.334	immune system process
GO:0016043	0.329	cellular component organization
GO:0055085	0.323	transmembrane transport
GO:0009605	0.322	response to external stimulus
GO:0098662	0.305	inorganic cation transmembrane transport
GO:0071310	0.301	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.725	organelle
GO:0005737	0.719	cytoplasm
GO:0043229	0.719	intracellular organelle
GO:0043231	0.693	intracellular membrane-bounded organelle
GO:0032991	0.318	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]