StarFunc result for job id Q99575

User Input

>input (1024 residues)
MSNAKERKHAKKMRNQPTNVTLSSGFVADRGVKHHSGGEKPFQAQKQEPHPGTSRQRQTR
VNPHSLPDPEVNEQSSSKGMFRKKGGWKAGPEGTSQEIPKYITASTFAQARAAEISAMLK
AVTQKSSNSLVFQTLPRHMRRRAMSHNVKRLPRRLQEIAQKEAEKAVHQKKEHSKNKCHK
ARRCHMNRTLEFNRRQKKNIWLETHIWHAKRFHMVKKWGYCLGERPTVKSHRACYRAMTN
RCLLQDLSYYCCLELKGKEEEILKALSGMCNIDTGLTFAAVHCLSGKRQGSLVLYRVNKY
PREMLGPVTFIWKSQRTPGDPSESRQLWIWLHPTLKQDILEEIKAACQCVEPIKSAVCIA
DPLPTPSQEKSQTELPDEKIGKKRKRKDDGENAKPIKKIIGDGTRDPCLPYSWISPTTGI
IISDLTMEMNRFRLIGPLSHSILTEAIKAASVHTVGEDTEETPHRWWIETCKKPDSVSLH
CRQEAIFELLGGITSPAEIPAGTILGLTVGDPRINLPQKKSKALPNPEKCQDNEKVRQLL
LEGVPVECTHSFIWNQDICKSVTENKISDQDLNRMRSELLVPGSQLILGPHESKIPILLI
QQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVHSQYKRSPNVP
GDFPDCPAGMLFAEEQAKNLLEKYKRRPPAKRPNYVKLGTLAPFCCPWEQLTQDWESRVQ
AYEEPSVASSPNGKESDLRRSEVPCAPMPKKTHQPSDEVGTSIEHPREAEEVMDAGCQES
AGPERITDQEASENHVAATGSHLCVLRSRKLLKQLSAWCGPSSEDSRGGRRAPGRGQQGL
TREACLSILGHFPRALVWVSLSLLSKGSPEPHTMICVPAKEDFLQLHEDWHYCGPQESKH
SDPFRSKILKQKEKKKREKRQKPGRASSDGPAGEEPVAGQEALTLGLWSGPLPRVTLHCS
RTLLGFVTQGDFSMAVGCGEALGFVSLTGLLDMLSSQPAAQRGLVLLRPPASLQYRFARI
AIEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99575	1.000	1.000	0.000	1024	1.000	1.000	Q99575.pdb.gz	POP1_HUMAN Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2
2	PDB:6ahrB	0.656	0.860	1.803E-101	774	0.753	0.996	6ahrB.pdb.gz	Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
3	PDB:7c79B	0.436	0.553	6.205E-26	793	0.166	0.214	7c79B.pdb.gz	Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.
4	PDB:1vloA	0.259	0.677	3.274E-7	364	0.060	0.168	1vloA.pdb.gz
5	PDB:4pabB	0.268	0.328	5.575E-7	824	0.061	0.075	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
6	PDB:1wsvA	0.271	0.685	6.115E-6	371	0.060	0.164	1wsvA.pdb.gz	Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
7	AFDB:B3DH92	0.055	0.059	3.321E-2	820	0.096	0.120	B3DH92.pdb.gz	B3DH92_DANRE Clock circadian regulator b OS=Danio rerio OX=7955 GN=clock3 PE=2 SV=1
8	AFDB:O15055	0.060	0.054	5.361E-2	1255	0.093	0.076	O15055.pdb.gz	PER2_HUMAN Period circadian protein homolog 2 OS=Homo sapiens OX=9606 GN=PER2 PE=1 SV=2
9	AFDB:Q8QGQ8	0.057	0.048	6.633E-2	1344	0.092	0.070	Q8QGQ8.pdb.gz	PER2_CHICK Period circadian protein homolog 2 OS=Gallus gallus OX=9031 GN=PER2 PE=2 SV=1
10	AFDB:Q9W542	0.055	0.056	1.729E-1	986	0.101	0.104	Q9W542.pdb.gz	Q9W542_DROME LD07342p OS=Drosophila melanogaster OX=7227 GN=mip130 PE=1 SV=3
11	PDB:4pxbA	0.050	0.103	3.174E-1	423	0.014	0.033	4pxbA.pdb.gz	Structural insights into the substrate specificity of (s)-ureidoglycolate amidohydrolase and its comparison with allantoate amidohydrolase.
12	PDB:2iukA	0.042	0.049	4.142E-1	835	0.008	0.010	2iukA.pdb.gz	Crystal Structures of Vegetative Soybean Lipoxygenase Vlx-B and Vlx-D, and Comparisons with Seed Isoforms Lox-1 and Lox-3.
13	PDB:2j9eB	0.039	0.233	4.368E-1	119	0.011	0.092	2j9eB.pdb.gz	Structure of Glnk1 with Bound Effectors Indicates Regulatory Mechanism for Ammonia Uptake.
14	PDB:3geiA	0.078	0.171	4.368E-1	428	0.012	0.028	3geiA.pdb.gz
15	PDB:4axgA	0.051	0.242	5.125E-1	181	0.008	0.044	4axgA.pdb.gz	Crystal Structure of a Minimal Eif4E-Cup Complex Revelas a General Mechanism of Eif4E Regulation in Translational Repression
16	AFDB:B3DK47	0.058	0.048	5.575E-1	1398	0.111	0.082	B3DK47.pdb.gz
17	AFDB:J3KRL7	0.056	0.049	8.534E-1	1267	0.104	0.084	J3KRL7.pdb.gz	J3KRL7_HUMAN Period circadian regulator 1 OS=Homo sapiens OX=9606 GN=PER1 PE=1 SV=1
18	AFDB:Q23MT7	0.072	0.068	1.896	1195	0.102	0.087	Q23MT7.pdb.gz	TTL6A_TETTS Probable beta-tubulin polyglutamylase OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=Ttll6a PE=3 SV=2
19	AFDB:Q9LS08	0.048	0.119	2.346	344	0.036	0.108	Q9LS08.pdb.gz	BH032_ARATH Transcription factor AIG1 OS=Arabidopsis thaliana OX=3702 GN=BHLH32 PE=1 SV=1
20	AFDB:X2JDH0	0.059	0.041	2.610	1799	0.095	0.054	X2JDH0.pdb.gz	X2JDH0_DROME Radish, isoform I OS=Drosophila melanogaster OX=7227 GN=rsh PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99575	0.0	2116	1024	1.000	1.000	POP1_HUMAN Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2
2	Q9UTA4	7.93e-17	87.8	698	0.078	0.115	POPI_SCHPO Ribonucleases P/MRP protein subunit pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pop1 PE=3 SV=1
3	F4IL30	8.62e-16	84.7	826	0.070	0.087	POP1_ARATH Ribonucleases P/MRP protein subunit POP1 OS=Arabidopsis thaliana OX=3702 GN=POP1 PE=1 SV=1
4	P41812	9.72e-08	58.5	875	0.047	0.055	POP1_YEAST Ribonucleases P/MRP protein subunit POP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06978 POP1	1.8e-35	134.4	Ribonucleases P/MRP protein subunit POP1
2	PF08170 POPLD	2.7e-23	93.5	POPLD (NUC188) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385787

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350098	0.999	Ribonuclease P/MRP protein subunit POP5
2	9606.ENSP00000389182	0.999	Ribonuclease P protein subunit p30
3	9606.ENSP00000465213	0.999	Ribonuclease P protein subunit p29
4	9606.ENSP00000409799	0.998	Ribonuclease P protein subunit p21
5	9606.ENSP00000317691	0.994	Ribonuclease P protein subunit p25
6	9606.ENSP00000478982	0.993	Ribonuclease P protein subunit p38
7	9606.ENSP00000412894	0.990	Ribonuclease P protein subunit p14
8	9606.ENSP00000369391	0.984	Ribonuclease P protein subunit p40
9	9606.ENSP00000304353	0.983	Ribonuclease P protein subunit p20
10	9606.ENSP00000437256	0.922	Endoribonuclease Dicer
11	9606.ENSP00000266987	0.920	RISC-loading complex subunit TARBP2
12	9606.ENSP00000440915	0.916	Mitochondrial ribonuclease P catalytic subunit
13	9606.ENSP00000244230	0.913	U3 small nucleolar ribonucleoprotein protein MPP10
14	9606.ENSP00000274054	0.913	H/ACA ribonucleoprotein complex non-core subunit NAF1
15	9606.ENSP00000232888	0.911	U3 small nucleolar RNA-interacting protein 2
16	9606.ENSP00000168216	0.908	3-hydroxyacyl-CoA dehydrogenase type-2
17	9606.ENSP00000434995	0.906	Polyribonucleotide 5'-hydroxyl-kinase Clp1
18	9606.ENSP00000263694	0.904	U5 small nuclear ribonucleoprotein 40 kDa protein
19	9606.ENSP00000332198	0.903	H/ACA ribonucleoprotein complex subunit 3
20	9606.ENSP00000220592	0.902	Protein argonaute-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0033204	1.000	ribonuclease P RNA binding
GO:0004526	1.000	ribonuclease P activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.992	primary metabolic process
GO:0008033	0.982	tRNA processing
GO:0044260	0.941	cellular macromolecule metabolic process
GO:0000966	0.915	RNA 5'-end processing
GO:1901575	0.889	organic substance catabolic process
GO:0006401	0.821	RNA catabolic process
GO:0034661	0.628	ncRNA catabolic process
GO:0099116	0.398	tRNA 5'-end processing
GO:0065007	0.376	biological regulation
GO:0001682	0.363	tRNA 5'-leader removal
GO:0050789	0.361	regulation of biological process
GO:0071840	0.345	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0030681	0.999	multimeric ribonuclease P complex
GO:0140513	0.999	nuclear protein-containing complex
GO:0000172	0.998	ribonuclease MRP complex
GO:0005615	0.996	extracellular space
GO:0005655	0.760	nucleolar ribonuclease P complex
GO:0005737	0.750	cytoplasm
GO:0005829	0.418	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.26.5	1.000	ribonuclease P.

[back to server]