StarFunc result for job id Q99581

User Input

>input (238 residues)
MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADR
ANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGK
RYAYRFDFQGLAQACQPPPAHAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNL
MAASAGVAPAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHYH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99581	0.999	0.999	3.535E-39	238	1.000	1.000	Q99581.pdb.gz	FEV_HUMAN Protein FEV OS=Homo sapiens OX=9606 GN=FEV PE=1 SV=1
2	AFDB:A3FEM2	0.455	0.461	3.005E-23	235	0.592	0.600	A3FEM2.pdb.gz	FEV_DANRE Protein FEV OS=Danio rerio OX=7955 GN=fev PE=2 SV=1
3	AFDB:A0A2R8QGN6	0.420	0.218	7.316E-20	460	0.479	0.248	A0A2R8QGN6.pdb.gz	A0A2R8QGN6_DANRE Fli-1 proto-oncogene, ETS transcription factor a OS=Danio rerio OX=7955 GN=cb855 PE=1 SV=1
4	AFDB:Q5PR65	0.413	0.231	2.393E-19	427	0.479	0.267	Q5PR65.pdb.gz	Q5PR65_DANRE Erg protein OS=Danio rerio OX=7955 GN=zgc:103429 PE=2 SV=1
5	AFDB:A0A024R3M5	0.416	0.220	2.711E-19	452	0.462	0.243	A0A024R3M5.pdb.gz
6	AFDB:P81270	0.402	0.198	4.780E-18	486	0.462	0.226	P81270.pdb.gz	ERG_MOUSE Transcriptional regulator ERG OS=Mus musculus OX=10090 GN=Erg PE=1 SV=2
7	AFDB:Q7SXF5	0.400	0.205	5.087E-18	466	0.416	0.212	Q7SXF5.pdb.gz
8	AFDB:P29776	0.393	0.199	6.987E-17	475	0.391	0.196	P29776.pdb.gz	ETS6_DROME DNA-binding protein D-ETS-6 OS=Drosophila melanogaster OX=7227 GN=Ets21C PE=2 SV=2
9	AFDB:Q22355	0.431	0.277	1.581E-15	377	0.412	0.260	Q22355.pdb.gz	AST1_CAEEL Transcription factor ast-1 OS=Caenorhabditis elegans OX=6239 GN=ast-1 PE=1 SV=2
10	AFDB:Q6ZN32	0.376	0.249	3.378E-13	361	0.336	0.222	Q6ZN32.pdb.gz	ETV3L_HUMAN ETS translocation variant 3-like protein OS=Homo sapiens OX=9606 GN=ETV3L PE=1 SV=1
11	PDB:1ldjA	0.184	0.065	9.985E-2	725	0.038	0.012	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
12	PDB:2xv4S	0.169	0.108	1.452E-1	399	0.029	0.018	2xv4S.pdb.gz
13	PDB:2zcwA	0.219	0.256	1.983E-1	194	0.034	0.041	2zcwA.pdb.gz
14	PDB:4byyA	0.214	0.223	2.247E-1	226	0.042	0.044	4byyA.pdb.gz
15	PDB:5k1yD	0.167	0.361	2.883E-1	92	0.042	0.109	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
16	PDB:2fe3B	0.195	0.293	4.192E-1	143	0.067	0.112	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
17	PDB:5i2dG	0.238	0.279	6.488E-1	195	0.055	0.067	5i2dG.pdb.gz	Structural basis of transcription activation.
18	PDB:1r1uC	0.125	0.273	7.350E-1	98	0.046	0.112	1r1uC.pdb.gz
19	PDB:4fx0B	0.191	0.297	7.350E-1	135	0.067	0.119	4fx0B.pdb.gz
20	PDB:4mtdD	0.160	0.242	7.350E-1	151	0.034	0.053	4mtdD.pdb.gz	Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99581	4.02e-172	474	238	1.000	1.000	FEV_HUMAN Protein FEV OS=Homo sapiens OX=9606 GN=FEV PE=1 SV=1
2	O70132	4.66e-148	414	237	0.962	0.966	FEV_RAT Protein FEV OS=Rattus norvegicus OX=10116 GN=Fev PE=2 SV=2
3	Q8QZW2	4.66e-148	414	237	0.962	0.966	FEV_MOUSE Protein FEV OS=Mus musculus OX=10090 GN=Fev PE=2 SV=1
4	A3FEM2	7.36e-95	279	235	0.609	0.617	FEV_DANRE Protein FEV OS=Danio rerio OX=7955 GN=fev PE=2 SV=1
5	P26323	4.60e-62	202	452	0.450	0.237	FLI1_MOUSE Friend leukemia integration 1 transcription factor OS=Mus musculus OX=10090 GN=Fli1 PE=1 SV=1
6	Q01543	6.38e-61	199	452	0.441	0.232	FLI1_HUMAN Friend leukemia integration 1 transcription factor OS=Homo sapiens OX=9606 GN=FLI1 PE=1 SV=1
7	Q9PU61	3.23e-60	197	451	0.450	0.237	Q9PU61_DANRE Fli-1 protein OS=Danio rerio OX=7955 GN=fli1a PE=1 SV=1
8	A0A2R8QGN6	3.45e-60	197	460	0.450	0.233	A0A2R8QGN6_DANRE Fli-1 proto-oncogene, ETS transcription factor a OS=Danio rerio OX=7955 GN=cb855 PE=1 SV=1
9	Q5PR65	3.91e-58	191	427	0.378	0.211	Q5PR65_DANRE Erg protein OS=Danio rerio OX=7955 GN=zgc:103429 PE=2 SV=1
10	P11308	1.26e-57	191	479	0.445	0.221	ERG_HUMAN Transcriptional regulator ERG OS=Homo sapiens OX=9606 GN=ERG PE=1 SV=3
11	P81270	1.49e-57	191	486	0.441	0.216	ERG_MOUSE Transcriptional regulator ERG OS=Mus musculus OX=10090 GN=Erg PE=1 SV=2
12	Q22355	1.41e-55	184	377	0.345	0.218	AST1_CAEEL Transcription factor ast-1 OS=Caenorhabditis elegans OX=6239 GN=ast-1 PE=1 SV=2
13	Q5MBG6	8.47e-54	181	458	0.324	0.168	Q5MBG6_DANRE ETS family transcription factor efr1 OS=Danio rerio OX=7955 GN=fli1b PE=2 SV=1
14	P29776	4.10e-51	174	475	0.328	0.164	ETS6_DROME DNA-binding protein D-ETS-6 OS=Drosophila melanogaster OX=7227 GN=Ets21C PE=2 SV=2
15	P15036	7.48e-37	136	469	0.265	0.134	ETS2_HUMAN Protein C-ets-2 OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1
16	P27577	8.54e-37	136	440	0.265	0.143	ETS1_MOUSE Protein C-ets-1 OS=Mus musculus OX=10090 GN=Ets1 PE=1 SV=2
17	P41156	9.62e-37	135	441	0.265	0.143	ETS1_RAT Protein C-ets-1 OS=Rattus norvegicus OX=10116 GN=Ets1 PE=1 SV=1
18	P15037	1.01e-36	136	468	0.265	0.135	ETS2_MOUSE Protein C-ets-2 OS=Mus musculus OX=10090 GN=Ets2 PE=1 SV=1
19	A0A8I6GB76	1.04e-36	136	492	0.265	0.128	A0A8I6GB76_RAT ETS proto-oncogene 2, transcription factor OS=Rattus norvegicus OX=10116 GN=Ets2 PE=3 SV=1
20	P14921	1.10e-36	135	441	0.265	0.143	ETS1_HUMAN Protein C-ets-1 OS=Homo sapiens OX=9606 GN=ETS1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00178 Ets	1.1e-30	117.1	Ets-domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261707	0.766	Sodium-dependent serotonin transporter
2	9606.ENSP00000329093	0.746	Tryptophan hydroxylase 2
3	9606.ENSP00000366347	0.643	Homeobox protein Nkx-2.2
4	9606.ENSP00000250018	0.584	Belongs to the biopterin-dependent aromatic amino acid hydroxylase family
5	9606.ENSP00000316244	0.579	5-hydroxytryptamine receptor 1A
6	9606.ENSP00000312631	0.525	Insulinoma-associated protein 1
7	9606.ENSP00000332208	0.521	DNA-binding protein RFX6
8	9606.ENSP00000347684	0.516	LIM homeobox transcription factor 1-beta
9	9606.ENSP00000368758	0.514	Cortexin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.943	protein binding
GO:0140110	0.937	transcription regulator activity
GO:0003700	0.895	DNA-binding transcription factor activity
GO:0000976	0.844	transcription cis-regulatory region binding
GO:0000977	0.755	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.748	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.527	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0048518	0.976	positive regulation of biological process
GO:0009893	0.966	positive regulation of metabolic process
GO:0010604	0.963	positive regulation of macromolecule metabolic process
GO:0009987	0.962	cellular process
GO:0009889	0.906	regulation of biosynthetic process
GO:0031326	0.896	regulation of cellular biosynthetic process
GO:0019219	0.895	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.885	regulation of DNA-templated transcription
GO:0032502	0.841	developmental process
GO:0009891	0.764	positive regulation of biosynthetic process
GO:0048522	0.757	positive regulation of cellular process
GO:0048856	0.749	anatomical structure development
GO:0032501	0.728	multicellular organismal process
GO:0031325	0.715	positive regulation of cellular metabolic process
GO:0045944	0.712	positive regulation of transcription by RNA polymerase II
GO:0007275	0.562	multicellular organism development
GO:0048731	0.443	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.985	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]