StarFunc result for job id Q99583

User Input

>input (582 residues)
MSIETLLEAARFLEWQAQQQQRAREEQERLRLEQEREQEQKKANSLARLAHTLPVEEPRM
EAPPLPLSPPAPPPAPPPPLATPAPLTVIPIPVVTNSPQPLPPPPPLPAAAQPLPLAPRQ
PALVGAPGLSIKEPAPLPSRPQVPTPAPLLPDSKATIPPNGSPKPLQPLPTPVLTIAPHP
GVQPQLAPQQPPPPTLGTLKLAPAEEVKSSEQKKRPGGIGTREVHNKLEKNRRAHLKECF
ETLKRNIPNVDDKKTSNLSVLRTALRYIQSLKRKEKEYEHEMERLAREKIATQQRLAELK
HELSQWMDVLEIDRVLRQTGQPEDDQASTSTASEGEDNIDEDMEEDRAGLGPPKLSHRPQ
PELLKSTLPPPSTTPAPLPPHPHPHPHSVALPPAHLPVQQQQPQQKTPLPAPPPPPAAPA
QTLVPAPAHLVATAGGGSTVIAHTATTHASVIQTVNHVLQGPGGKHIAHIAPSAPSPAVQ
LAPATPPIGHITVHPATLNHVAHLGSQLPLYPQPVAVSHIAHTLSHQQVNGTAGLGPPAT
VMAKPAVGAQVVHHPQLVGQTVLNPVTMVTMPSFPVSTLKLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08789	0.376	0.371	1.652E-72	591	0.942	0.927	O08789.pdb.gz	MNT_MOUSE Max-binding protein MNT OS=Mus musculus OX=10090 GN=Mnt PE=2 SV=2
2	AFDB:M9NDN0	0.148	0.147	4.150E-5	583	0.180	0.180	M9NDN0.pdb.gz	M9NDN0_DROME Mnt, isoform J OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
3	AFDB:Q9USS2	0.069	0.051	1.009E-3	872	0.134	0.089	Q9USS2.pdb.gz	PPK29_SCHPO Serine/threonine-protein kinase ppk29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk29 PE=1 SV=1
4	AFDB:G8BGH3	0.084	0.069	1.938E-3	724	0.194	0.156	G8BGH3.pdb.gz	G8BGH3_CANPC BCR1 OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=BCR1 PE=4 SV=1
5	AFDB:A0A3B3IRZ4	0.095	0.054	2.084E-3	1222	0.156	0.074	A0A3B3IRZ4.pdb.gz	A0A3B3IRZ4_HUMAN IQ motif and Sec7 domain ArfGEF 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
6	AFDB:O60583	0.050	0.041	2.084E-3	730	0.134	0.107	O60583.pdb.gz	CCNT2_HUMAN Cyclin-T2 OS=Homo sapiens OX=9606 GN=CCNT2 PE=1 SV=2
7	AFDB:Q582B7	0.068	0.059	2.785E-3	695	0.143	0.119	Q582B7.pdb.gz	Q582B7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.690 PE=4 SV=1
8	AFDB:O18660	0.088	0.074	3.219E-3	729	0.149	0.119	O18660.pdb.gz	O18660_DROME BZIP transcription factor OS=Drosophila melanogaster OX=7227 GN=vri PE=2 SV=1
9	AFDB:Q38FG4	0.077	0.039	4.303E-3	1366	0.137	0.059	Q38FG4.pdb.gz	Q38FG4_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2290 PE=4 SV=1
10	AFDB:Q585K3	0.089	0.087	6.648E-3	601	0.143	0.138	Q585K3.pdb.gz	Q585K3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.26G5.220 PE=4 SV=1
11	PDB:3ojaA	0.077	0.091	2.894E-1	482	0.041	0.050	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
12	PDB:7kgbo	0.064	0.375	4.234	87	0.027	0.184	7kgbo.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
13	PDB:7a5fA	0.092	0.265	5.264	162	0.040	0.142	7a5fA.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
14	PDB:7abzQ	0.073	0.324	6.085	117	0.003	0.017	7abzQ.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
15	PDB:5mrcEE	0.046	0.083	6.543	288	0.015	0.031	5mrcEE.pdb.gz	The structure of the yeast mitochondrial ribosome.
16	PDB:7suk5	0.076	0.125	7.035	296	0.041	0.081	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
17	PDB:6zx9C	0.047	0.095	7.564	257	0.019	0.043	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
18	PDB:6pskR	0.048	0.305	8.133	72	0.014	0.111	6pskR.pdb.gz
19	PDB:7pubF9	0.086	0.129	8.133	342	0.036	0.061	7pubF9.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
20	PDB:7wfeBF	0.043	0.141	8.133	154	0.005	0.019	7wfeBF.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08789	0.0	800	591	0.940	0.926	MNT_MOUSE Max-binding protein MNT OS=Mus musculus OX=10090 GN=Mnt PE=2 SV=2
2	Q99583	0.0	1117	582	1.000	1.000	MNT_HUMAN Max-binding protein MNT OS=Homo sapiens OX=9606 GN=MNT PE=1 SV=1
3	E1JJE8	4.32e-20	97.1	789	0.079	0.058	E1JJE8_DROME Mnt, isoform F OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
4	M9NGP0	4.40e-20	97.1	790	0.079	0.058	M9NGP0_DROME Mnt, isoform I OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
5	Q9W4Q7	4.48e-20	97.1	790	0.079	0.058	Q9W4Q7_DROME Mnt, isoform D OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=3
6	Q8SY46	4.67e-20	96.3	582	0.079	0.079	Q8SY46_DROME GH28809p OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
7	M9NDN0	4.94e-20	96.3	583	0.079	0.079	M9NDN0_DROME Mnt, isoform J OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
8	E1JJD1	5.37e-20	96.3	581	0.079	0.079	E1JJD1_DROME Mnt, isoform G OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
9	O46042	5.68e-20	95.9	582	0.079	0.079	O46042_DROME EG:114E2.2 protein OS=Drosophila melanogaster OX=7227 GN=Mnt PE=4 SV=1
10	X2JDM5	7.21e-20	96.3	716	0.079	0.064	X2JDM5_DROME Mnt, isoform K OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
11	P52164	3.20e-10	61.2	160	0.064	0.231	MAX_RAT Protein max OS=Rattus norvegicus OX=10116 GN=Max PE=1 SV=1
12	P28574	4.26e-10	60.8	160	0.064	0.231	MAX_MOUSE Protein max OS=Mus musculus OX=10090 GN=Max PE=1 SV=2
13	P61244	8.19e-10	60.1	160	0.053	0.194	MAX_HUMAN Protein max OS=Homo sapiens OX=9606 GN=MAX PE=1 SV=1
14	F6WCI9	9.17e-09	55.8	118	0.065	0.322	F6WCI9_HUMAN MAX interactor 1, dimerization protein (Fragment) OS=Homo sapiens OX=9606 GN=MXI1 PE=1 SV=1
15	P91664	1.21e-08	56.6	161	0.057	0.205	MAX_DROME Protein max OS=Drosophila melanogaster OX=7227 GN=Max PE=1 SV=1
16	A0A0S2Z3Y0	2.03e-08	56.6	192	0.064	0.193	A0A0S2Z3Y0_HUMAN MAX interactor 1 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=MXI1 PE=2 SV=1
17	Q9BW11	2.13e-08	57.0	206	0.057	0.160	MAD3_HUMAN Max dimerization protein 3 OS=Homo sapiens OX=9606 GN=MXD3 PE=1 SV=1
18	Q07016	3.40e-08	55.5	163	0.052	0.184	MAX_XENLA Protein max OS=Xenopus laevis OX=8355 GN=max PE=2 SV=1
19	O09015	3.77e-08	56.6	228	0.089	0.228	MXI1_RAT Max-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Mxi1 PE=2 SV=1
20	P50540	4.84e-08	56.2	228	0.064	0.162	MXI1_MOUSE Max-interacting protein 1 OS=Mus musculus OX=10090 GN=Mxi1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05600 CDK5RAP3	33	14.6	CDK5 regulatory subunit-associated protein 3
2	PF00010 HLH	3.7e-09	47.7	Helix-loop-helix DNA-binding domain
3	PF05565 Sipho_Gp157	55	15.2	Siphovirus Gp157

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000174618

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246912	0.904	Max-like protein X
2	9606.ENSP00000362649	0.842	Histone deacetylase 1
3	9606.ENSP00000337889	0.815	Max dimerization protein 4
4	9606.ENSP00000351490	0.814	Protein max
5	9606.ENSP00000479618	0.788	Myc proto-oncogene protein
6	9606.ENSP00000264444	0.785	Max dimerization protein 1
7	9606.ENSP00000378402	0.719	Paired amphipathic helix protein Sin3a
8	9606.ENSP00000417273	0.707	Cytoplasmic protein NCK1
9	9606.ENSP00000312834	0.657	MLX-interacting protein
10	9606.ENSP00000386394	0.648	NIF3-like protein 1
11	9606.ENSP00000296099	0.642	Urocortin
12	9606.ENSP00000369424	0.626	Histone-binding protein RBBP7
13	9606.ENSP00000320886	0.606	Carbohydrate-responsive element-binding protein
14	9606.ENSP00000363041	0.602	CDGSH iron-sulfur domain-containing protein 1
15	9606.ENSP00000381333	0.600	Corticotropin-releasing factor receptor 1
16	9606.ENSP00000273986	0.567	CDGSH iron-sulfur domain-containing protein 2
17	9606.ENSP00000219905	0.555	MAX gene-associated protein
18	9606.ENSP00000274368	0.551	Corticotropin-releasing factor-binding protein
19	9606.ENSP00000262394	0.547	WD repeat and SOCS box-containing protein 1
20	9606.ENSP00000339933	0.536	Pyruvate kinase PKLR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	0.998	sequence-specific DNA binding
GO:0003690	0.951	double-stranded DNA binding
GO:0001067	0.947	transcription regulatory region nucleic acid binding
GO:1990837	0.940	sequence-specific double-stranded DNA binding
GO:0003682	0.935	chromatin binding
GO:0000976	0.928	transcription cis-regulatory region binding
GO:0000977	0.815	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.789	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001217	0.741	DNA-binding transcription repressor activity
GO:0001227	0.687	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000987	0.380	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.987	regulation of primary metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0009987	0.986	cellular process
GO:0019219	0.980	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.978	negative regulation of biological process
GO:0010468	0.971	regulation of gene expression
GO:0009889	0.969	regulation of biosynthetic process
GO:0048523	0.967	negative regulation of cellular process
GO:0044237	0.959	cellular metabolic process
GO:0031326	0.951	regulation of cellular biosynthetic process
GO:0051252	0.950	regulation of RNA metabolic process
GO:0006355	0.943	regulation of DNA-templated transcription
GO:0006357	0.720	regulation of transcription by RNA polymerase II
GO:0051172	0.715	negative regulation of nitrogen compound metabolic process
GO:0031324	0.714	negative regulation of cellular metabolic process
GO:0071704	0.683	organic substance metabolic process
GO:0006807	0.665	nitrogen compound metabolic process
GO:0010605	0.648	negative regulation of macromolecule metabolic process
GO:0044238	0.632	primary metabolic process
GO:0050896	0.620	response to stimulus
GO:0000122	0.530	negative regulation of transcription by RNA polymerase II
GO:0043170	0.518	macromolecule metabolic process
GO:0051716	0.466	cellular response to stimulus
GO:0048518	0.407	positive regulation of biological process
GO:0048522	0.367	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.560	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]