StarFunc result for job id Q99584

User Input

>input (98 residues)
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKM
KSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P79342	0.978	0.978	1.264E-13	98	0.908	0.908	P79342.pdb.gz	S10AD_BOVIN Protein S100-A13 OS=Bos taurus OX=9913 GN=S100A13 PE=3 SV=2
2	AFDB:P31725	0.825	0.722	5.740E-7	113	0.327	0.283	P31725.pdb.gz	S10A9_MOUSE Protein S100-A9 OS=Mus musculus OX=10090 GN=S100a9 PE=1 SV=3
3	AFDB:P50116	0.770	0.671	7.427E-7	113	0.357	0.310	P50116.pdb.gz	S10A9_RAT Protein S100-A9 OS=Rattus norvegicus OX=10116 GN=S100a9 PE=1 SV=3
4	PDB:6zdyA	0.738	0.672	1.077E-6	108	0.296	0.269	6zdyA.pdb.gz	Divalent cations influence the dimerization mode of murine S100A9 protein by modulating its disulfide bond pattern.
5	AFDB:Q6S5I3	0.883	0.805	1.166E-6	108	0.255	0.231	Q6S5I3.pdb.gz	S115A_MOUSE Protein S100-A15A OS=Mus musculus OX=10090 GN=S100a15a PE=3 SV=1
6	AFDB:Q5T7Y6	0.732	0.498	1.243E-6	147	0.347	0.231	Q5T7Y6.pdb.gz	Q5T7Y6_HUMAN Protein S100 OS=Homo sapiens OX=9606 GN=S100A1 PE=1 SV=1
7	AFDB:P50543	0.823	0.823	1.508E-6	98	0.327	0.327	P50543.pdb.gz	S10AB_MOUSE Protein S100-A11 OS=Mus musculus OX=10090 GN=S100a11 PE=1 SV=1
8	AFDB:P50115	0.822	0.901	2.081E-6	89	0.214	0.236	P50115.pdb.gz	S10A8_RAT Protein S100-A8 OS=Rattus norvegicus OX=10116 GN=S100a8 PE=1 SV=3
9	AFDB:P31949	0.796	0.747	2.220E-6	105	0.347	0.324	P31949.pdb.gz	S10AB_HUMAN Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2
10	AFDB:Q96FQ6	0.823	0.787	3.484E-6	103	0.306	0.291	Q96FQ6.pdb.gz	S10AG_HUMAN Protein S100-A16 OS=Homo sapiens OX=9606 GN=S100A16 PE=1 SV=1
11	AFDB:Q9D708	0.747	0.602	3.716E-6	124	0.306	0.242	Q9D708.pdb.gz	S10AG_MOUSE Protein S100-A16 OS=Mus musculus OX=10090 GN=S100a16 PE=1 SV=1
12	PDB:7psqG	0.732	0.668	1.026E-5	108	0.276	0.250	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
13	PDB:2lucA	0.736	0.692	1.328E-5	105	0.306	0.286	2lucA.pdb.gz
14	PDB:2m0rA	0.688	0.652	1.416E-5	104	0.347	0.327	2m0rA.pdb.gz
15	PDB:5hloC	0.812	0.851	1.416E-5	93	0.214	0.226	5hloC.pdb.gz	Crystal structure of human S100A8 in complex with zinc and calcium.
16	PDB:2k2fA	0.671	0.704	6.231E-5	93	0.306	0.323	2k2fA.pdb.gz	S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
17	PDB:2wc8D	0.698	0.732	6.231E-5	93	0.286	0.301	2wc8D.pdb.gz	The Crystal Structures of Human S100A12 in Apo Form and in Complex with Zinc: New Insights Into S100A12 Oligomerisation.
18	PDB:5csnA	0.796	0.827	7.087E-5	94	0.235	0.245	5csnA.pdb.gz	Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
19	PDB:1k96A	0.756	0.827	1.186E-4	89	0.296	0.326	1k96A.pdb.gz	Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
20	PDB:5hydA	0.648	0.659	1.439E-4	96	0.255	0.260	5hydA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99584	2.07e-66	196	98	1.000	1.000	S10AD_HUMAN Protein S100-A13 OS=Homo sapiens OX=9606 GN=S100A13 PE=1 SV=1
2	P79342	2.49e-59	178	98	0.908	0.908	S10AD_BOVIN Protein S100-A13 OS=Bos taurus OX=9913 GN=S100A13 PE=3 SV=2
3	P97352	5.35e-55	167	98	0.827	0.827	S10AD_MOUSE Protein S100-A13 OS=Mus musculus OX=10090 GN=S100a13 PE=1 SV=1
4	Q9HCY8	1.73e-18	75.5	104	0.357	0.337	S10AE_HUMAN Protein S100-A14 OS=Homo sapiens OX=9606 GN=S100A14 PE=1 SV=1
5	P50116	3.67e-15	67.0	113	0.357	0.310	S10A9_RAT Protein S100-A9 OS=Rattus norvegicus OX=10116 GN=S100a9 PE=1 SV=3
6	P31725	5.90e-13	61.6	113	0.316	0.274	S10A9_MOUSE Protein S100-A9 OS=Mus musculus OX=10090 GN=S100a9 PE=1 SV=3
7	A0A060YVE5	1.56e-12	60.1	95	0.316	0.326	A0A060YVE5_ONCMY S100 calcium binding protein, beta (neural) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00045272001 PE=4 SV=1
8	Q96FQ6	1.69e-12	60.1	103	0.296	0.282	S10AG_HUMAN Protein S100-A16 OS=Homo sapiens OX=9606 GN=S100A16 PE=1 SV=1
9	A0A060YDS7	1.12e-11	57.8	95	0.306	0.316	A0A060YDS7_ONCMY S100 calcium binding protein, beta (neural) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00040819001 PE=4 SV=1
10	P31949	1.61e-11	57.8	105	0.327	0.305	S10AB_HUMAN Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2
11	Q9D708	1.68e-11	58.2	124	0.265	0.210	S10AG_MOUSE Protein S100-A16 OS=Mus musculus OX=10090 GN=S100a16 PE=1 SV=1
12	P80310	2.77e-11	56.6	92	0.276	0.293	S10AC_PIG Protein S100-A12 OS=Sus scrofa OX=9823 GN=S100A12 PE=1 SV=2
13	P80511	3.56e-11	56.6	92	0.276	0.293	S10AC_HUMAN Protein S100-A12 OS=Homo sapiens OX=9606 GN=S100A12 PE=1 SV=2
14	P07091	9.14e-11	55.5	101	0.296	0.287	S10A4_MOUSE Protein S100-A4 OS=Mus musculus OX=10090 GN=S100a4 PE=1 SV=1
15	P50543	9.30e-11	55.5	98	0.316	0.316	S10AB_MOUSE Protein S100-A11 OS=Mus musculus OX=10090 GN=S100a11 PE=1 SV=1
16	P05942	1.30e-10	55.1	101	0.296	0.287	S10A4_RAT Protein S100-A4 OS=Rattus norvegicus OX=10116 GN=S100a4 PE=2 SV=1
17	A0A0S2Z4H2	1.47e-10	55.1	94	0.337	0.351	A0A0S2Z4H2_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100A1 PE=2 SV=1
18	P23297	1.47e-10	55.1	94	0.337	0.351	S10A1_HUMAN Protein S100-A1 OS=Homo sapiens OX=9606 GN=S100A1 PE=1 SV=2
19	P56565	2.59e-10	54.3	94	0.327	0.340	S10A1_MOUSE Protein S100-A1 OS=Mus musculus OX=10090 GN=S100a1 PE=1 SV=2
20	P33763	2.61e-10	54.3	92	0.327	0.348	S10A5_HUMAN Protein S100-A5 OS=Homo sapiens OX=9606 GN=S100A5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13499 EF-hand_7	2.8e+02	13.4	EF-hand domain pair
2	PF01023 S_100	1e-11	55.5	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357688

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261205	0.998	Synaptotagmin-1
2	9606.ENSP00000480791	0.997	Fibroblast growth factor 1
3	9606.ENSP00000263339	0.993	Interleukin-1 alpha
4	9606.ENSP00000364210	0.931	Advanced glycosylation end product-specific receptor
5	9606.ENSP00000378307	0.768	Protein polybromo-1
6	9606.ENSP00000482841	0.739	Cellular retinoic acid-binding protein 2
7	9606.ENSP00000357709	0.710	Protein S100-A6
8	9606.ENSP00000344547	0.709	Prothymosin alpha
9	9606.ENSP00000357801	0.709	Protein S100-A10
10	9606.ENSP00000357702	0.696	Protein S100-A3
11	9606.ENSP00000357697	0.683	Protein S100-A2
12	9606.ENSP00000298527	0.677	C-type lectin domain family 1 member B
13	9606.ENSP00000385923	0.641	Nucleobindin-1
14	9606.ENSP00000320430	0.640	S100 calcium binding protein Z
15	9606.ENSP00000447942	0.569	Prefoldin subunit 5
16	9606.ENSP00000291700	0.556	Protein S100-B
17	9606.ENSP00000357712	0.556	S100 calcium binding protein A7
18	9606.ENSP00000286428	0.539	Prefoldin subunit 3
19	9606.ENSP00000332296	0.538	Retinoic acid receptor beta
20	9606.ENSP00000357718	0.505	Protein S100-A7A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005509	1.000	calcium ion binding
GO:0005102	0.999	signaling receptor binding
GO:0042803	0.999	protein homodimerization activity
GO:0005507	0.993	copper ion binding
GO:0017134	0.990	fibroblast growth factor binding
GO:0008270	0.847	zinc ion binding
GO:1901363	0.337	heterocyclic compound binding
GO:0003676	0.330	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.979	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0048522	0.960	positive regulation of cellular process
GO:0009987	0.942	cellular process
GO:0019222	0.921	regulation of metabolic process
GO:0060255	0.905	regulation of macromolecule metabolic process
GO:1902533	0.876	positive regulation of intracellular signal transduction
GO:0010468	0.845	regulation of gene expression
GO:0043122	0.801	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051239	0.766	regulation of multicellular organismal process
GO:0001817	0.758	regulation of cytokine production
GO:0050896	0.720	response to stimulus
GO:0009893	0.719	positive regulation of metabolic process
GO:0043123	0.663	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032652	0.624	regulation of interleukin-1 production
GO:0010604	0.608	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005829	0.997	cytosol
GO:0005654	0.996	nucleoplasm
GO:0005615	0.992	extracellular space
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0071944	0.981	cell periphery
GO:0016020	0.959	membrane
GO:0005886	0.918	plasma membrane
GO:0031982	0.840	vesicle
GO:0032991	0.542	protein-containing complex
GO:1903561	0.473	extracellular vesicle
GO:0070062	0.396	extracellular exosome
GO:0048471	0.307	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]