StarFunc result for job id Q99590

User Input

>input (1463 residues)
MKKKTVCTLNMGDKKYEDMEGEENGDNTISTGLLYSEADRCPICLNCLLEKEVGFPESCN
HVFCMTCILKWAETLASCPIDRKPFQAVFKFSALEGYVKVQVKKQLRETKDKKNENSFEK
QVSCHENSKSCIRRKAIVREDLLSAKVCDLKWIHRNSLYSETGGKKNAAIKINKPQRSNW
STNQCFRNFFSNMFSSVSHSGESSFTYRAYCTEFIEASEISALIRQKRHELELSWFPDTL
PGIGRIGFIPWNVETEVLPLISSVLPRTIFPTSTISFEHFGTSCKGYALAHTQEGEEKKQ
TSGTSNTRGSRRKPAMTTPTRRSTRNTRAETASQSQRSPISDNSGCDAPGNSNPSLSVPS
SAESEKQTRQAPKRKSVRRGRKPPLLKKKLRSSVAAPEKSSSNDSVDEETAESDTSPVLE
KEHQPDVDSSNICTVQTHVENQSANCLKSCNEQIEESEKHTANYDTEERVGSSSSESCAQ
DLPVLVGEEGEVKKLENTGIEANVLCLESEISENILEKGGDPLEKQDQISGLSQSEVKTD
VCTVHLPNDFPTCLTSESKVYQPVSCPLSDLSENVESVVNEEKITESSLVEITEHKDFTL
KTEELIESPKLESSEGEIIQTVDRQSVKSPEVQLLGHVETEDVEIIATCDTFGNEDFNNI
QDSENNLLKNNLLNTKLEKSLEEKNESLTEHPRSTELPKTHIEQIQKHFSEDNNEMIPME
CDSFCSDQNESEVEPSVNADLKQMNENSVTHCSENNMPSSDLADEKVETVSQPSESPKDT
IDKTKKPRTRRSRFHSPSTTWSPNKDTPQEKKRPQSPSPRRETGKESRKSQSPSPKNESA
RGRKKSRSQSPKKDIARERRQSQSRSPKRDTTRESRRSESLSPRRETSRENKRSQPRVKD
SSPGEKSRSQSRERESDRDGQRRERERRTRKWSRSRSHSRSPSRCRTKSKSSSFGRIDRD
SYSPRWKGRWANDGWRCPRGNDRYRKNDPEKQNENTRKEKNDIHLDADDPNSADKHRNDC
PNWITEKINSGPDPRTRNPEKLKESHWEENRNENSGNSWNKNFGSGWVSNRGRGRGNRGR
GTYRSSFAYKDQNENRWQNRKPLSGNSNSSGSESFKFVEQQSYKRKSEQEFSFDTPADRS
GWTSASSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMKQEEETSGQDSSLKDQTNQQVDG
SQLPINMMQPQMNVMQQQMNAQHQPMNIFPYPVGVHAPLMNIQRNPFNIHPQLPLHLHTG
VPLMQVATPTSVSQGLPPPPPPPPPSQQVNYIASQPDGKQLQGIPSSSHVSNNMSTPVLP
APTAAPGNTGMVQGPSSGNTSSSSHSKASNAAVKLAESKVSVAVEASADSSKTDKKLQIQ
EKAAQEVKLAIKPFYQNKDITKEEYKEIVRKAVDKVCHSKSGEVNSTKVANLVKAYVDKY
KYSRKGSQKKTLEEPVSTEKNIG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99590	0.999	0.999	0.000	1463	1.000	1.000	Q99590.pdb.gz	SCAFB_HUMAN Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2
2	AFDB:Q63625	0.080	0.072	1.097E-19	1685	0.207	0.180	Q63625.pdb.gz	PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Phrf1 PE=1 SV=2
3	AFDB:Q9P1Y6	0.071	0.064	5.062E-19	1649	0.202	0.180	Q9P1Y6.pdb.gz	PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3
4	AFDB:Q63624	0.056	0.065	6.564E-10	1258	0.161	0.188	Q63624.pdb.gz	SFR19_RAT Splicing factor, arginine/serine-rich 19 OS=Rattus norvegicus OX=10116 GN=Scaf1 PE=1 SV=2
5	AFDB:Q9H7N4	0.060	0.066	7.133E-9	1312	0.151	0.168	Q9H7N4.pdb.gz	SFR19_HUMAN Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3
6	AFDB:Q9VNE0	0.073	0.050	4.299E-7	2296	0.210	0.134	Q9VNE0.pdb.gz	Q9VNE0_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2926 PE=1 SV=1
7	AFDB:Q80Z37	0.053	0.074	4.064E-4	1033	0.087	0.124	Q80Z37.pdb.gz	TOPRS_MOUSE E3 ubiquitin-protein ligase Topors OS=Mus musculus OX=10090 GN=Topors PE=1 SV=1
8	AFDB:E7F1A2	0.048	0.069	6.630E-4	999	0.105	0.153	E7F1A2.pdb.gz
9	AFDB:Q9ULT6	0.033	0.051	3.458E-3	936	0.076	0.119	Q9ULT6.pdb.gz	ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens OX=9606 GN=ZNRF3 PE=1 SV=3
10	AFDB:Q9NS56	0.051	0.070	4.155E-3	1045	0.087	0.122	Q9NS56.pdb.gz	TOPRS_HUMAN E3 ubiquitin-protein ligase Topors OS=Homo sapiens OX=9606 GN=TOPORS PE=1 SV=1
11	PDB:4a0cF	0.033	0.546	8.754E-3	80	0.013	0.237	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
12	PDB:2lgvA	0.035	0.420	2.330E-2	100	0.014	0.210	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
13	PDB:5a31B	0.033	0.443	2.477E-2	84	0.012	0.202	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
14	PDB:7oniR	0.034	0.494	2.477E-2	86	0.012	0.198	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
15	PDB:5l9uB	0.031	0.492	4.295E-2	71	0.012	0.239	5l9uB.pdb.gz
16	PDB:8a3tU	0.038	0.398	5.160E-2	114	0.014	0.175	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
17	PDB:4r8pL	0.033	0.175	2.107E-1	254	0.014	0.079	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
18	PDB:5gm6a	0.032	0.344	3.655E-1	123	0.009	0.106	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:5gmkq	0.033	0.116	4.391E-1	387	0.006	0.023	5gmkq.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
20	PDB:7qsmW	0.032	0.247	4.668E-1	116	0.011	0.138	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8VXG7	0.0	2605	1271	0.869	1.000	F8VXG7_HUMAN SR-related CTD associated factor 11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=1
2	Q99590	0.0	3016	1463	1.000	1.000	SCAFB_HUMAN Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2
3	Q63625	1.39e-27	124	1685	0.059	0.051	PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Phrf1 PE=1 SV=2
4	Q9H7N4	1.47e-27	124	1312	0.049	0.054	SFR19_HUMAN Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3
5	Q9P1Y6	2.88e-27	123	1649	0.037	0.033	PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3
6	Q63624	7.47e-27	122	1258	0.046	0.054	SFR19_RAT Splicing factor, arginine/serine-rich 19 OS=Rattus norvegicus OX=10116 GN=Scaf1 PE=1 SV=2
7	Q9VNE0	1.49e-16	88.6	2296	0.025	0.016	Q9VNE0_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2926 PE=1 SV=1
8	Q6NP07	1.53e-10	68.6	1489	0.018	0.017	Q6NP07_DROME LD08594p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG2926 PE=2 SV=1
9	A0A0B4KF97	4.59e-10	67.0	874	0.018	0.030	A0A0B4KF97_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2926 PE=4 SV=1
10	F1SE69	3.51e-06	54.3	979	0.012	0.018	F1SE69_PIG TOP1 binding arginine/serine rich protein, E3 ubiquitin ligase OS=Sus scrofa OX=9823 GN=TOPORS PE=4 SV=3
11	Q80Z37	5.22e-06	53.9	1033	0.012	0.017	TOPRS_MOUSE E3 ubiquitin-protein ligase Topors OS=Mus musculus OX=10090 GN=Topors PE=1 SV=1
12	F1N329	5.68e-06	53.5	1037	0.012	0.017	F1N329_BOVIN TOP1 binding arginine/serine rich protein, E3 ubiquitin ligase OS=Bos taurus OX=9913 GN=TOPORS PE=4 SV=3
13	Q9NS56	5.84e-06	53.5	1045	0.012	0.017	TOPRS_HUMAN E3 ubiquitin-protein ligase Topors OS=Homo sapiens OX=9606 GN=TOPORS PE=1 SV=1
14	A0A0R4ICA2	1.23e-05	52.4	939	0.013	0.020	A0A0R4ICA2_DANRE E3 ubiquitin-protein ligase Topors OS=Danio rerio OX=7955 GN=toporsb PE=4 SV=1
15	P28990	6.96e-05	49.7	532	0.018	0.051	ICP0_EHV1B E3 ubiquitin-protein ligase ICP0 OS=Equine herpesvirus 1 (strain Ab4p) OX=31520 GN=63 PE=1 SV=1
16	P87662	1.61e-04	48.1	419	0.018	0.064	P87662_9ALPH Transcriptional protein OS=Equid alphaherpesvirus 1 OX=10326 GN=ICP0 PE=1 SV=1
17	D3ZC81	3.00e-04	47.0	324	0.012	0.056	D3ZC81_RAT Peroxisomal biogenesis factor 10 OS=Rattus norvegicus OX=10116 GN=Pex10 PE=1 SV=1
18	O60683	7.21e-04	45.8	326	0.012	0.055	PEX10_HUMAN Peroxisome biogenesis factor 10 OS=Homo sapiens OX=9606 GN=PEX10 PE=1 SV=1
19	Q9V8P9	0.001	45.8	1038	0.014	0.019	TOPRS_DROME E3 ubiquitin-protein ligase Topors OS=Drosophila melanogaster OX=7227 GN=Topors PE=1 SV=1
20	Q06554	0.003	44.7	1556	0.012	0.012	IRC20_YEAST Uncharacterized ATP-dependent helicase IRC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRC20 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	3.7e+02	12.4	Prokaryotic RING finger family 4
2	PF12861 zf-ANAPC11	79	14.7	Anaphase-promoting complex subunit 11 RING-H2 finger
3	PF00097 zf-C3HC4	0.77	21.0	Zinc finger, C3HC4 type (RING finger)
4	PF13923 zf-C3HC4_2	0.12	23.6	Zinc finger, C3HC4 type (RING finger)
5	PF13920 zf-C3HC4_3	1.5	20.0	Zinc finger, C3HC4 type (RING finger)
6	PF15227 zf-C3HC4_4	78	14.8	zinc finger of C3HC4-type, RING
7	PF12678 zf-rbx1	4.7	18.9	RING-H2 zinc finger domain
8	PF13639 zf-RING_2	0.0032	29.1	Ring finger domain
9	PF14634 zf-RING_5	2.8	19.3	zinc-RING finger domain
10	PF13445 zf-RING_UBOX	3	19.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358374

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307863	0.885	Splicing factor U2AF 65 kDa subunit
2	9606.ENSP00000282516	0.883	Nipped-B-like protein
3	9606.ENSP00000218089	0.847	Cohesin subunit SA-2
4	9606.ENSP00000245838	0.844	THO complex subunit 2
5	9606.ENSP00000362441	0.837	Transcriptional regulator ATRX
6	9606.ENSP00000358242	0.836	Arginine/serine-rich protein PNISR
7	9606.ENSP00000354957	0.817	Structural maintenance of chromosomes protein 5
8	9606.ENSP00000275034	0.812	PH-interacting protein
9	9606.ENSP00000303427	0.752	Sister chromatid cohesion protein PDS5 homolog A
10	9606.ENSP00000388566	0.724	Caspase-4
11	9606.ENSP00000311513	0.719	Remodeling and spacing factor 1
12	9606.ENSP00000446093	0.714	Gamma-tubulin complex component 2
13	9606.ENSP00000472998	0.703	U1 small nuclear ribonucleoprotein 70 kDa
14	9606.ENSP00000248846	0.701	Gamma-tubulin complex component 6
15	9606.ENSP00000260383	0.701	Gamma-tubulin complex component 4
16	9606.ENSP00000376276	0.689	Serine/arginine-rich splicing factor 2
17	9606.ENSP00000261965	0.688	Gamma-tubulin complex component 3
18	9606.ENSP00000480316	0.683	Gamma-tubulin complex component 5
19	9606.ENSP00000356785	0.679	Nucleoside diphosphate kinase 7
20	9606.ENSP00000378307	0.666	Protein polybromo-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003824	0.669	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.982	primary metabolic process
GO:0010467	0.981	gene expression
GO:0016070	0.966	RNA metabolic process
GO:0006396	0.953	RNA processing
GO:0071840	0.951	cellular component organization or biogenesis
GO:0008380	0.943	RNA splicing
GO:0016043	0.937	cellular component organization
GO:0016071	0.935	mRNA metabolic process
GO:0000398	0.894	mRNA splicing, via spliceosome
GO:0022607	0.848	cellular component assembly
GO:0022618	0.833	ribonucleoprotein complex assembly
GO:0065007	0.702	biological regulation
GO:0050789	0.682	regulation of biological process
GO:0000245	0.659	spliceosomal complex assembly
GO:0050794	0.649	regulation of cellular process
GO:0019222	0.393	regulation of metabolic process
GO:0060255	0.381	regulation of macromolecule metabolic process
GO:0048518	0.302	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	1.000	nuclear body
GO:0005730	0.999	nucleolus
GO:0005829	0.595	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]