StarFunc result for job id Q99593

User Input

>input (518 residues)
MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHE
RELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNK
WSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQ
PRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSD
DMELHRMSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGP
SQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQ
QQGLGASYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYSSCTVTTVQPMDR
LPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPG
TLQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70326	0.665	0.665	3.246E-80	518	0.961	0.961	P70326.pdb.gz	TBX5_MOUSE T-box transcription factor TBX5 OS=Mus musculus OX=10090 GN=Tbx5 PE=1 SV=2
2	AFDB:Q9PWE8	0.531	0.528	1.228E-75	521	0.890	0.885	Q9PWE8.pdb.gz	TBX5_CHICK T-box transcription factor TBX5 OS=Gallus gallus OX=9031 GN=TBX5 PE=1 SV=1
3	AFDB:O93288	0.375	0.359	1.160E-47	541	0.571	0.547	O93288.pdb.gz	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
4	AFDB:B3DGX3	0.388	0.370	4.297E-45	543	0.521	0.497	B3DGX3.pdb.gz
5	AFDB:G1K2W9	0.397	0.475	1.595E-39	430	0.442	0.533	G1K2W9.pdb.gz
6	AFDB:Q9EPZ6	0.345	0.293	1.271E-30	613	0.307	0.259	Q9EPZ6.pdb.gz	TBX18_MOUSE T-box transcription factor TBX18 OS=Mus musculus OX=10090 GN=Tbx18 PE=1 SV=1
7	AFDB:Q19691	0.364	0.443	3.866E-30	423	0.272	0.333	Q19691.pdb.gz	TBX2_CAEEL T-box protein 2 OS=Caenorhabditis elegans OX=6239 GN=tbx-2 PE=1 SV=1
8	AFDB:Q8AXX2	0.360	0.404	1.772E-29	460	0.297	0.335	Q8AXX2.pdb.gz	TBX1_DANRE T-box transcription factor TBX1 OS=Danio rerio OX=7955 GN=tbx1 PE=2 SV=1
9	AFDB:P24781	0.360	0.429	7.662E-29	432	0.255	0.306	P24781.pdb.gz	TBXT_XENLA T-box transcription factor T OS=Xenopus laevis OX=8355 GN=tbxt PE=1 SV=1
10	AFDB:D4A4W8	0.358	0.423	8.124E-29	436	0.263	0.312	D4A4W8.pdb.gz	D4A4W8_RAT T-box transcription factor T OS=Rattus norvegicus OX=10116 GN=Tbxt PE=4 SV=2
11	PDB:3fxiC	0.143	0.383	3.060E-3	140	0.033	0.121	3fxiC.pdb.gz
12	PDB:3t6qC	0.148	0.378	3.648E-3	139	0.031	0.115	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
13	PDB:5ijdC	0.145	0.391	1.993E-2	137	0.027	0.102	5ijdC.pdb.gz	TLR4/MD-2 activation by a synthetic agonist with no similarity to LPS.
14	PDB:7ea3J	0.090	0.058	2.114E-2	883	0.037	0.022	7ea3J.pdb.gz
15	PDB:4ziqA	0.121	0.054	4.025E-2	1450	0.031	0.011	4ziqA.pdb.gz
16	PDB:7tysA	0.121	0.157	4.268E-2	361	0.037	0.053	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
17	PDB:7zdzA	0.091	0.135	4.268E-2	325	0.023	0.037	7zdzA.pdb.gz
18	PDB:3b2dC	0.127	0.329	4.525E-2	139	0.027	0.101	3b2dC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
19	PDB:2r51A	0.141	0.218	5.720E-2	288	0.035	0.062	2r51A.pdb.gz
20	PDB:1yycA	0.103	0.240	6.818E-2	174	0.029	0.086	1yycA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O93288	0.0	526	541	0.573	0.549	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
2	P70325	0.0	521	552	0.583	0.547	TBX4_MOUSE T-box transcription factor TBX4 OS=Mus musculus OX=10090 GN=Tbx4 PE=1 SV=3
3	P70326	0.0	1022	518	0.961	0.961	TBX5_MOUSE T-box transcription factor TBX5 OS=Mus musculus OX=10090 GN=Tbx5 PE=1 SV=2
4	Q5I2P1	0.0	1015	517	0.958	0.959	TBX5_RAT T-box transcription factor TBX5 OS=Rattus norvegicus OX=10116 GN=Tbx5 PE=2 SV=1
5	Q99593	0.0	1083	518	1.000	1.000	TBX5_HUMAN T-box transcription factor TBX5 OS=Homo sapiens OX=9606 GN=TBX5 PE=1 SV=2
6	Q9IAK8	0.0	702	492	0.707	0.744	TBX5A_DANRE T-box transcription factor TBX5-A OS=Danio rerio OX=7955 GN=tbx5a PE=2 SV=2
7	Q9PWE8	0.0	974	521	0.890	0.885	TBX5_CHICK T-box transcription factor TBX5 OS=Gallus gallus OX=9031 GN=TBX5 PE=1 SV=1
8	P57082	4.13e-175	506	545	0.566	0.538	TBX4_HUMAN T-box transcription factor TBX4 OS=Homo sapiens OX=9606 GN=TBX4 PE=1 SV=2
9	F1R688	1.62e-161	471	543	0.514	0.490	F1R688_DANRE T-box transcription factor 4 OS=Danio rerio OX=7955 GN=tbx4 PE=4 SV=1
10	E3W6T6	3.12e-143	420	422	0.369	0.453	E3W6T6_DANRE T-box 5b isoform X1 OS=Danio rerio OX=7955 GN=si:dkey-114c15.2 PE=2 SV=1
11	Q8UW76	3.15e-78	254	440	0.249	0.293	TBX20_CHICK T-box transcription factor TBX20 OS=Gallus gallus OX=9031 GN=TBX20 PE=2 SV=1
12	A0A1D5NXF3	5.46e-78	261	732	0.255	0.180	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
13	Q19691	1.07e-77	252	423	0.230	0.281	TBX2_CAEEL T-box protein 2 OS=Caenorhabditis elegans OX=6239 GN=tbx-2 PE=1 SV=1
14	Q13207	1.30e-77	259	712	0.234	0.170	TBX2_HUMAN T-box transcription factor TBX2 OS=Homo sapiens OX=9606 GN=TBX2 PE=1 SV=3
15	Q9ES03	1.50e-77	252	445	0.247	0.288	TBX20_MOUSE T-box transcription factor TBX20 OS=Mus musculus OX=10090 GN=Tbx20 PE=2 SV=3
16	Q60707	3.32e-77	258	711	0.234	0.170	TBX2_MOUSE T-box transcription factor TBX2 OS=Mus musculus OX=10090 GN=Tbx2 PE=1 SV=3
17	B0R122	3.46e-77	258	686	0.234	0.176	B0R122_DANRE T-box transcription factor 2a OS=Danio rerio OX=7955 GN=tbx-a PE=4 SV=1
18	Q7ZTU9	1.72e-76	256	687	0.230	0.173	TBX2_DANRE T-box transcription factor TBX2b OS=Danio rerio OX=7955 GN=tbx2b PE=1 SV=4
19	Q9UMR3	1.89e-76	249	447	0.222	0.257	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4
20	B8JKS6	4.58e-76	254	689	0.239	0.180	B8JKS6_DANRE T-box transcription factor 3a OS=Danio rerio OX=7955 GN=tbx-b PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00907 T-box	1e-75	265.3	T-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000015692

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000005795	0.982	NK2 homeobox 5
2	60711.ENSCSAP00000003179	0.899	Uncharacterized protein
3	60711.ENSCSAP00000007705	0.896	WW domain containing transcription regulator 1
4	60711.ENSCSAP00000012979	0.847	GATA binding protein 4
5	60711.ENSCSAP00000012943	0.833	Catenin beta 1
6	60711.ENSCSAP00000002028	0.811	NK2 homeobox 3
7	60711.ENSCSAP00000014820	0.795	Yes-associated protein 1
8	60711.ENSCSAP00000017204	0.758	Natriuretic peptide A
9	60711.ENSCSAP00000002917	0.749	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
10	60711.ENSCSAP00000014944	0.727	Heart and neural crest derivatives expressed 2
11	60711.ENSCSAP00000010566	0.723	Homeobox D9
12	60711.ENSCSAP00000011360	0.721	Spalt-like transcription factor 4
13	60711.ENSCSAP00000004907	0.711	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2
14	60711.ENSCSAP00000010870	0.706	Myocyte enhancer factor 2C
15	60711.ENSCSAP00000012766	0.694	ISL LIM homeobox 1
16	60711.ENSCSAP00000005357	0.681	Myocardin
17	60711.ENSCSAP00000012799	0.679	Fibroblast growth factor 10
18	60711.ENSCSAP00000013685	0.674	GATA binding protein 6
19	60711.ENSCSAP00000005020	0.663	PDZ and LIM domain 7 (enigma)
20	60711.ENSCSAP00000006048	0.658	K(lysine) acetyltransferase 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	0.996	DNA-binding transcription factor activity
GO:0000976	0.995	transcription cis-regulatory region binding
GO:0000981	0.986	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.985	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.906	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.895	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.516	DNA-binding transcription activator activity
GO:0001228	0.512	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0019904	0.473	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0048856	0.995	anatomical structure development
GO:0080090	0.988	regulation of primary metabolic process
GO:0048731	0.988	system development
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0010556	0.983	regulation of macromolecule biosynthetic process
GO:0019219	0.979	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.963	positive regulation of cellular process
GO:0072359	0.960	circulatory system development
GO:0035108	0.943	limb morphogenesis
GO:0031326	0.940	regulation of cellular biosynthetic process
GO:0006355	0.930	regulation of DNA-templated transcription
GO:0048513	0.926	animal organ development
GO:0007507	0.911	heart development
GO:0035113	0.905	embryonic appendage morphogenesis
GO:0009893	0.852	positive regulation of metabolic process
GO:0010604	0.842	positive regulation of macromolecule metabolic process
GO:0048869	0.785	cellular developmental process
GO:0030154	0.783	cell differentiation
GO:0051173	0.780	positive regulation of nitrogen compound metabolic process
GO:0031325	0.780	positive regulation of cellular metabolic process
GO:0009891	0.734	positive regulation of biosynthetic process
GO:0045935	0.727	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.720	positive regulation of DNA-templated transcription
GO:0009888	0.705	tissue development
GO:0048519	0.696	negative regulation of biological process
GO:0030326	0.684	embryonic limb morphogenesis
GO:0050896	0.658	response to stimulus
GO:0035136	0.484	forelimb morphogenesis
GO:0006357	0.474	regulation of transcription by RNA polymerase II
GO:0009887	0.472	animal organ morphogenesis
GO:0048523	0.459	negative regulation of cellular process
GO:0051239	0.453	regulation of multicellular organismal process
GO:0045944	0.432	positive regulation of transcription by RNA polymerase II
GO:0007154	0.414	cell communication
GO:0023052	0.381	signaling
GO:0051716	0.335	cellular response to stimulus
GO:0050793	0.330	regulation of developmental process
GO:0042127	0.321	regulation of cell population proliferation
GO:0035295	0.301	tube development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.960	intracellular organelle lumen
GO:0005654	0.927	nucleoplasm
GO:0032991	0.877	protein-containing complex
GO:0005737	0.616	cytoplasm
GO:0043232	0.501	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]