StarFunc result for job id Q99595

User Input

>input (171 residues)
MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAP
QLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGG
ILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35092	0.910	0.910	1.396E-24	171	0.965	0.965	O35092.pdb.gz	TI17A_RAT Mitochondrial import inner membrane translocase subunit Tim17-A OS=Rattus norvegicus OX=10116 GN=Timm17a PE=2 SV=1
2	AFDB:O60830	0.829	0.824	1.350E-20	172	0.760	0.756	O60830.pdb.gz	TI17B_HUMAN Mitochondrial import inner membrane translocase subunit Tim17-B OS=Homo sapiens OX=9606 GN=TIMM17B PE=1 SV=1
3	AFDB:Q7PLT4	0.836	0.826	3.889E-18	173	0.637	0.630	Q7PLT4.pdb.gz	Q7PLT4_DROME Translocase of the inner mitochondrial membrane 17b, isoform A OS=Drosophila melanogaster OX=7227 GN=Tim17b PE=1 SV=1
4	AFDB:Q9SP35	0.784	0.558	4.887E-14	243	0.474	0.333	Q9SP35.pdb.gz	TI172_ARATH Mitochondrial import inner membrane translocase subunit TIM17-2 OS=Arabidopsis thaliana OX=3702 GN=TIM17-2 PE=1 SV=2
5	AFDB:P87130	0.794	0.827	2.236E-13	164	0.427	0.445	P87130.pdb.gz	TIM17_SCHPO Mitochondrial import inner membrane translocase subunit tim17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim17 PE=3 SV=1
6	AFDB:Q9LN27	0.788	0.622	4.195E-13	218	0.480	0.376	Q9LN27.pdb.gz	TI171_ARATH Mitochondrial import inner membrane translocase subunit TIM17-1 OS=Arabidopsis thaliana OX=3702 GN=TIM17-1 PE=2 SV=1
7	AFDB:P39515	0.777	0.838	6.055E-13	158	0.444	0.481	P39515.pdb.gz	TIM17_YEAST Mitochondrial import inner membrane translocase subunit TIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM17 PE=1 SV=1
8	AFDB:Q9LYG1	0.649	0.829	9.844E-10	133	0.322	0.414	Q9LYG1.pdb.gz	TI173_ARATH Mitochondrial import inner membrane translocase subunit TIM17-3 OS=Arabidopsis thaliana OX=3702 GN=TIM17-3 PE=2 SV=1
9	AFDB:P32897	0.689	0.535	3.498E-7	222	0.199	0.153	P32897.pdb.gz	TIM23_YEAST Mitochondrial import inner membrane translocase subunit TIM23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM23 PE=1 SV=1
10	AFDB:Q59YG5	0.686	0.542	6.227E-7	218	0.199	0.156	Q59YG5.pdb.gz	Q59YG5_CANAL Mitochondrial import inner membrane translocase subunit TIM23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM23 PE=3 SV=1
11	PDB:7cgpA	0.374	0.427	1.921E-3	147	0.164	0.190	7cgpA.pdb.gz
12	PDB:6lo8A	0.375	0.490	3.079E-3	129	0.146	0.194	6lo8A.pdb.gz
13	PDB:7psaY	0.416	0.485	5.778E-3	140	0.193	0.236	7psaY.pdb.gz	Cryo-electron microscopy reveals how acetogenins inhibit mitochondrial respiratory complex I.
14	PDB:5xtcV	0.443	0.514	1.738E-2	140	0.158	0.193	5xtcV.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
15	PDB:8cs9Q	0.184	0.101	1.499	390	0.111	0.049	8cs9Q.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
16	PDB:7vpzF	0.247	0.177	1.579	301	0.082	0.047	7vpzF.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
17	PDB:1jebA	0.156	0.177	1.664	142	0.146	0.176	1jebA.pdb.gz	The role of beta chains in the control of the hemoglobin oxygen binding function: chimeric human/mouse proteins, structure, and function.
18	PDB:6mjpG	0.296	0.168	1.754	354	0.111	0.054	6mjpG.pdb.gz	Structural basis of unidirectional export of lipopolysaccharide to the cell surface.
19	PDB:4jrzA	0.186	0.200	2.280	155	0.129	0.142	4jrzA.pdb.gz	Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
20	PDB:3rx6A	0.229	0.213	2.403	187	0.105	0.096	3rx6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99595	1.97e-124	348	171	1.000	1.000	TI17A_HUMAN Mitochondrial import inner membrane translocase subunit Tim17-A OS=Homo sapiens OX=9606 GN=TIMM17A PE=1 SV=1
2	Q9Z0V8	4.05e-120	338	171	0.959	0.959	TI17A_MOUSE Mitochondrial import inner membrane translocase subunit Tim17-A OS=Mus musculus OX=10090 GN=Timm17a PE=1 SV=1
3	O35092	5.21e-120	337	171	0.965	0.965	TI17A_RAT Mitochondrial import inner membrane translocase subunit Tim17-A OS=Rattus norvegicus OX=10116 GN=Timm17a PE=2 SV=1
4	O60830	3.97e-94	272	172	0.760	0.756	TI17B_HUMAN Mitochondrial import inner membrane translocase subunit Tim17-B OS=Homo sapiens OX=9606 GN=TIMM17B PE=1 SV=1
5	Q9Z0V7	2.20e-93	270	172	0.749	0.744	TI17B_MOUSE Mitochondrial import inner membrane translocase subunit Tim17-B OS=Mus musculus OX=10090 GN=Timm17b PE=1 SV=1
6	Q7PLT4	1.57e-75	225	173	0.661	0.653	Q7PLT4_DROME Translocase of the inner mitochondrial membrane 17b, isoform A OS=Drosophila melanogaster OX=7227 GN=Tim17b PE=1 SV=1
7	Q9LN27	9.40e-47	154	218	0.474	0.372	TI171_ARATH Mitochondrial import inner membrane translocase subunit TIM17-1 OS=Arabidopsis thaliana OX=3702 GN=TIM17-1 PE=2 SV=1
8	Q9SP35	4.39e-46	152	243	0.456	0.321	TI172_ARATH Mitochondrial import inner membrane translocase subunit TIM17-2 OS=Arabidopsis thaliana OX=3702 GN=TIM17-2 PE=1 SV=2
9	P39515	3.26e-44	145	158	0.444	0.481	TIM17_YEAST Mitochondrial import inner membrane translocase subunit TIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM17 PE=1 SV=1
10	P87130	3.86e-40	135	164	0.433	0.451	TIM17_SCHPO Mitochondrial import inner membrane translocase subunit tim17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim17 PE=3 SV=1
11	Q9LYG1	8.71e-31	110	133	0.327	0.421	TI173_ARATH Mitochondrial import inner membrane translocase subunit TIM17-3 OS=Arabidopsis thaliana OX=3702 GN=TIM17-3 PE=2 SV=1
12	A0A1D8PI78	7.15e-08	52.0	184	0.240	0.223	TIM22_CANAL Mitochondrial import inner membrane translocase subunit TIM22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM22 PE=1 SV=1
13	Q94EH2	2.65e-07	50.4	210	0.222	0.181	TI222_ARATH Chloroplastic import inner membrane translocase subunit TIM22-2 OS=Arabidopsis thaliana OX=3702 GN=TIM22-2 PE=1 SV=1
14	Q6NKU9	9.96e-07	48.9	214	0.222	0.178	TI223_ARATH Mitochondrial import inner membrane translocase subunit TIM22-3 OS=Arabidopsis thaliana OX=3702 GN=TIM22-3 PE=2 SV=1
15	Q59YG5	2.16e-06	48.1	218	0.170	0.133	Q59YG5_CANAL Mitochondrial import inner membrane translocase subunit TIM23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM23 PE=3 SV=1
16	Q9CQ85	2.65e-06	47.8	194	0.199	0.175	TIM22_MOUSE Mitochondrial import inner membrane translocase subunit Tim22 OS=Mus musculus OX=10090 GN=Timm22 PE=1 SV=1
17	Q9Y584	3.31e-05	44.7	194	0.187	0.165	TIM22_HUMAN Mitochondrial import inner membrane translocase subunit Tim22 OS=Homo sapiens OX=9606 GN=TIMM22 PE=1 SV=2
18	P32897	3.60e-05	44.7	222	0.187	0.144	TIM23_YEAST Mitochondrial import inner membrane translocase subunit TIM23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM23 PE=1 SV=1
19	Q382K7	7.50e-05	43.1	152	0.129	0.145	Q382K7_TRYB2 Mitochondrial import inner membrane translocase subunit TIM22 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4870 PE=3 SV=1
20	Q12328	9.41e-05	43.5	207	0.146	0.121	TIM22_YEAST Mitochondrial import inner membrane translocase subunit TIM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM22 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02466 Tim17	1.5e-27	107.6	Tim17/Tim22/Tim23/Pmp24 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008584640.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008568211.1	0.993	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 12 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
2	482537.XP_008580421.1	0.992	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 9 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
3	482537.XP_008578242.1	0.987	Mitochondrial import inner membrane translocase subunit TIM44
4	482537.XP_008572050.1	0.978	Coronin-7 isoform X1
5	482537.XP_008590835.1	0.974	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments
6	482537.XP_008571340.1	0.966	grpE protein homolog 1, mitochondrial
7	482537.XP_008586602.1	0.957	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
8	482537.XP_008571006.1	0.943	Stress-70 protein, mitochondrial
9	482537.XP_008567819.1	0.928	Reactive oxygen species modulator 1
10	482537.XP_008584229.1	0.924	Mitochondrial import receptor subunit TOM40 homolog
11	482537.XP_008588769.1	0.924	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
12	482537.XP_008582965.1	0.922	dnaJ homolog subfamily C member 15
13	482537.XP_008579142.1	0.892	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 5 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
14	482537.XP_008587752.1	0.889	Mitochondrial import inner membrane translocase subunit Tim9
15	482537.XP_008578411.1	0.874	Mitochondrial import receptor subunit TOM40B
16	482537.XP_008571414.1	0.828	Mitochondrial-processing peptidase subunit alpha
17	482537.XP_008571906.1	0.809	Mitochondrial import inner membrane translocase subunit Tim10 B
18	482537.XP_008591274.1	0.787	Mitochondrial import inner membrane translocase subunit Tim22
19	482537.XP_008565094.1	0.786	Mitochondrial import receptor subunit TOM22 homolog
20	482537.XP_008590511.1	0.779	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005215	0.518	transporter activity
GO:0022857	0.489	transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006626	0.986	protein targeting to mitochondrion
GO:0065007	0.510	biological regulation
GO:0050789	0.405	regulation of biological process
GO:0050794	0.302	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.998	mitochondrial inner membrane
GO:0032991	0.969	protein-containing complex
GO:0070013	0.889	intracellular organelle lumen
GO:0098798	0.866	mitochondrial protein-containing complex
GO:0098796	0.863	membrane protein complex
GO:0098800	0.814	inner mitochondrial membrane protein complex
GO:0005634	0.600	nucleus
GO:0005744	0.467	TIM23 mitochondrial import inner membrane translocase complex
GO:0031981	0.370	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]