StarFunc result for job id Q99607

User Input

>input (663 residues)
MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYSGLELDDVHNG
IITDGTLCMTQDQILEGSFLLTDDNEATSHTMSTAEVLLNMESPSDILDEKQIFSTSEML
PDSDPAPAVTLPNYLFPASEPDALNRAGDTSDQEGHSLEEKASREESAKKTGKSKKRIRK
TKGNRSTSPVTDPSIPIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFK
LVDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLVVI
EDEDESSEATAAPPQASTASVASASTTRRTSSRVSSRSAPQGKGSSSWEKPKIQHVGLQP
SASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVAPVGSGSALTLQ
TIPLTTVLTNGPPASTTAPTQLVLQSVPAASTFKDTFTLQASFPLNASFQDSQVAAPGAP
LILSGLPQLLAGANRPTNPAPPTVTGAGPAGPSSQPPGTVIAAFIRTSGTTAAPRVKEGP
LRSSSYVQGMVTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLS
PPSRPTVGLTPVAELELSSGSGSLLMAEPSVTTSGSLLTRSPTPAPFSPFNPTSLIKMEP
HDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99607	0.999	0.999	5.047E-94	663	1.000	1.000	Q99607.pdb.gz	ELF4_HUMAN ETS-related transcription factor Elf-4 OS=Homo sapiens OX=9606 GN=ELF4 PE=1 SV=1
2	AFDB:Q9Z2U4	0.259	0.262	1.448E-73	655	0.781	0.791	Q9Z2U4.pdb.gz	ELF4_MOUSE ETS-related transcription factor Elf-4 OS=Mus musculus OX=10090 GN=Elf4 PE=1 SV=2
3	AFDB:G3V9V2	0.176	0.188	6.775E-31	615	0.373	0.402	G3V9V2.pdb.gz	G3V9V2_RAT E74 like ETS transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Elf1 PE=3 SV=1
4	AFDB:P32519	0.164	0.173	3.934E-30	619	0.353	0.378	P32519.pdb.gz	ELF1_HUMAN ETS-related transcription factor Elf-1 OS=Homo sapiens OX=9606 GN=ELF1 PE=1 SV=2
5	AFDB:O94842	0.066	0.069	1.816E-4	621	0.140	0.150	O94842.pdb.gz	TOX4_HUMAN TOX high mobility group box family member 4 OS=Homo sapiens OX=9606 GN=TOX4 PE=1 SV=1
6	AFDB:Q9FXI5	0.064	0.056	2.208E-4	794	0.139	0.116	Q9FXI5.pdb.gz	IQD32_ARATH Protein IQ-DOMAIN 32 OS=Arabidopsis thaliana OX=3702 GN=IQD32 PE=1 SV=3
7	AFDB:A4L7N3	0.086	0.086	2.357E-4	662	0.160	0.160	A4L7N3.pdb.gz	FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=2 SV=1
8	AFDB:P40657	0.080	0.071	2.685E-4	784	0.151	0.128	P40657.pdb.gz	SOX15_DROME Putative transcription factor SOX-15 OS=Drosophila melanogaster OX=7227 GN=Sox15 PE=2 SV=2
9	AFDB:O60393	0.068	0.066	3.484E-4	691	0.186	0.178	O60393.pdb.gz	NOBOX_HUMAN Homeobox protein NOBOX OS=Homo sapiens OX=9606 GN=NOBOX PE=1 SV=4
10	AFDB:Q9R0G8	0.051	0.029	7.135E-4	1455	0.149	0.068	Q9R0G8.pdb.gz	NRK_MOUSE Nik-related protein kinase OS=Mus musculus OX=10090 GN=Nrk PE=1 SV=2
11	PDB:1ldjA	0.073	0.068	1.070E-1	725	0.017	0.015	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
12	PDB:3i54D	0.082	0.205	1.582E-1	228	0.023	0.066	3i54D.pdb.gz	Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
13	PDB:4byyA	0.080	0.199	1.582E-1	226	0.017	0.049	4byyA.pdb.gz
14	PDB:4mtdD	0.063	0.251	1.689E-1	151	0.017	0.073	4mtdD.pdb.gz	Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.
15	PDB:4v8mAU	0.066	0.334	2.053E-1	85	0.021	0.165	4v8mAU.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
16	PDB:5i2dG	0.050	0.154	3.239E-1	195	0.006	0.021	5i2dG.pdb.gz	Structural basis of transcription activation.
17	PDB:3m8eA	0.073	0.349	3.458E-1	101	0.014	0.089	3m8eA.pdb.gz
18	PDB:2zcwA	0.090	0.253	3.939E-1	194	0.018	0.062	2zcwA.pdb.gz
19	PDB:5k1yD	0.050	0.299	3.939E-1	92	0.009	0.065	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
20	PDB:6dk4A	0.057	0.232	5.823E-1	135	0.015	0.074	6dk4A.pdb.gz	Crystal structure of Campylobacter jejuni peroxide regulator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99607	0.0	1336	663	1.000	1.000	ELF4_HUMAN ETS-related transcription factor Elf-4 OS=Homo sapiens OX=9606 GN=ELF4 PE=1 SV=1
2	Q9Z2U4	0.0	1026	655	0.781	0.791	ELF4_MOUSE ETS-related transcription factor Elf-4 OS=Mus musculus OX=10090 GN=Elf4 PE=1 SV=2
3	G3V9V2	4.00e-109	344	615	0.371	0.400	G3V9V2_RAT E74 like ETS transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Elf1 PE=3 SV=1
4	Q9EQY3	5.16e-109	344	615	0.371	0.400	Q9EQY3_RAT Ets-family transcription factor ELF1 OS=Rattus norvegicus OX=10116 GN=Elf1 PE=2 SV=1
5	P32519	1.47e-100	322	619	0.367	0.393	ELF1_HUMAN ETS-related transcription factor Elf-1 OS=Homo sapiens OX=9606 GN=ELF1 PE=1 SV=2
6	Q60775	2.64e-97	313	612	0.368	0.399	ELF1_MOUSE ETS-related transcription factor Elf-1 OS=Mus musculus OX=10090 GN=Elf1 PE=1 SV=1
7	Q15723	3.80e-73	249	593	0.220	0.246	ELF2_HUMAN ETS-related transcription factor Elf-2 OS=Homo sapiens OX=9606 GN=ELF2 PE=1 SV=2
8	Q9JHC9	7.72e-70	240	593	0.210	0.234	ELF2_MOUSE ETS-related transcription factor Elf-2 OS=Mus musculus OX=10090 GN=Elf2 PE=1 SV=1
9	B7Z720	4.45e-65	225	521	0.176	0.225	B7Z720_HUMAN E74-like factor 2 (Ets domain transcription factor), isoform CRA_b OS=Homo sapiens OX=9606 GN=ELF2 PE=2 SV=1
10	P20105	4.10e-49	186	829	0.118	0.094	E74EA_DROME Ecdysone-induced protein 74EF isoform A OS=Drosophila melanogaster OX=7227 GN=Eip74EF PE=2 SV=2
11	P11536	7.84e-49	186	883	0.118	0.088	E74EB_DROME Ecdysone-induced protein 74EF isoform B OS=Drosophila melanogaster OX=7227 GN=Eip74EF PE=2 SV=2
12	H2KYY1	2.92e-42	160	420	0.113	0.179	H2KYY1_CAEEL ETS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elf-1 PE=3 SV=1
13	Q400M2	5.66e-42	159	419	0.113	0.179	Q400M2_CAEEL ETS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elf-1 PE=3 SV=2
14	A4GTP4	8.60e-24	107	427	0.080	0.124	ELK1_RAT ETS domain-containing protein Elk-1 OS=Rattus norvegicus OX=10116 GN=Elk1 PE=1 SV=1
15	P41969	9.90e-24	106	429	0.078	0.121	ELK1_MOUSE ETS domain-containing protein Elk-1 OS=Mus musculus OX=10090 GN=Elk1 PE=1 SV=3
16	P19419	1.73e-23	105	428	0.065	0.100	ELK1_HUMAN ETS domain-containing protein Elk-1 OS=Homo sapiens OX=9606 GN=ELK1 PE=1 SV=2
17	Q01842	5.81e-23	106	732	0.074	0.067	POK_DROME Ets DNA-binding protein pokkuri OS=Drosophila melanogaster OX=7227 GN=aop PE=1 SV=2
18	Q9NZC4	4.27e-22	99.4	300	0.066	0.147	EHF_HUMAN ETS homologous factor OS=Homo sapiens OX=9606 GN=EHF PE=2 SV=1
19	O95238	1.76e-21	98.6	335	0.063	0.125	SPDEF_HUMAN SAM pointed domain-containing Ets transcription factor OS=Homo sapiens OX=9606 GN=SPDEF PE=1 SV=1
20	Q9WTP3	2.04e-21	98.2	325	0.063	0.129	SPDEF_MOUSE SAM pointed domain-containing Ets transcription factor OS=Mus musculus OX=10090 GN=Spdef PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12310 Elf-1_N	2.5e-26	103.9	Transcription factor protein N terminal
2	PF00178 Ets	4.5e-30	115.1	Ets-domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311280

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401980	0.768	Mitochondrial antiviral-signaling protein
2	9606.ENSP00000327168	0.674	Proline-rich protein 7
3	9606.ENSP00000471896	0.670	Interferon regulatory factor 3
4	9606.ENSP00000248071	0.601	Krueppel-like factor 2
5	9606.ENSP00000300305	0.571	Runt-related transcription factor 1
6	9606.ENSP00000264834	0.532	Krueppel-like factor 1
7	9606.ENSP00000384848	0.531	Proline-rich protein 5
8	9606.ENSP00000236147	0.529	L-selectin
9	9606.ENSP00000357733	0.527	Proline-rich protein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0006355	0.991	regulation of DNA-templated transcription
GO:0048518	0.989	positive regulation of biological process
GO:0048519	0.984	negative regulation of biological process
GO:0048583	0.970	regulation of response to stimulus
GO:0045944	0.970	positive regulation of transcription by RNA polymerase II
GO:0080134	0.956	regulation of response to stress
GO:0010605	0.956	negative regulation of macromolecule metabolic process
GO:0051239	0.944	regulation of multicellular organismal process
GO:0032101	0.906	regulation of response to external stimulus
GO:1903555	0.889	regulation of tumor necrosis factor superfamily cytokine production
GO:0032675	0.875	regulation of interleukin-6 production
GO:0031347	0.836	regulation of defense response
GO:0048585	0.770	negative regulation of response to stimulus
GO:0009987	0.752	cellular process
GO:0051241	0.717	negative regulation of multicellular organismal process
GO:0032680	0.705	regulation of tumor necrosis factor production
GO:0050727	0.682	regulation of inflammatory response
GO:0032102	0.659	negative regulation of response to external stimulus
GO:0001818	0.657	negative regulation of cytokine production
GO:0032652	0.650	regulation of interleukin-1 production
GO:0032715	0.649	negative regulation of interleukin-6 production
GO:0031348	0.614	negative regulation of defense response
GO:1903556	0.607	negative regulation of tumor necrosis factor superfamily cytokine production
GO:0032692	0.572	negative regulation of interleukin-1 production
GO:0048523	0.300	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.851	nuclear body
GO:0005737	0.790	cytoplasm
GO:0016605	0.539	PML body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]