StarFunc result for job id Q99608

User Input

>input (321 residues)
MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQA
PNDEGDPKALQQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIW
FPDMVKDVIGSYKKWCRSILRRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVA
LSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTFGDVRKLITEEFV
QMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEE
ARALREANPTAHYPRSSVSED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99608	1.000	1.000	5.153E-52	321	1.000	1.000	Q99608.pdb.gz	NECD_HUMAN Necdin OS=Homo sapiens OX=9606 GN=NDN PE=1 SV=1
2	AFDB:G3V7A4	0.394	0.389	6.453E-40	325	0.835	0.825	G3V7A4.pdb.gz	G3V7A4_RAT Necdin, MAGE family member OS=Rattus norvegicus OX=10116 GN=Ndn PE=4 SV=1
3	AFDB:Q5H907	0.396	0.248	2.933E-21	521	0.352	0.217	Q5H907.pdb.gz	Q5H907_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=1
4	AFDB:Q96MG7	0.388	0.409	7.854E-21	304	0.340	0.359	Q96MG7.pdb.gz	NSE3_HUMAN Non-structural maintenance of chromosomes element 3 homolog OS=Homo sapiens OX=9606 GN=NSMCE3 PE=1 SV=1
5	AFDB:Q9CPR8	0.392	0.449	9.737E-20	279	0.305	0.351	Q9CPR8.pdb.gz	NSE3_MOUSE Non-structural maintenance of chromosomes element 3 homolog OS=Mus musculus OX=10090 GN=Nsmce3 PE=1 SV=1
6	AFDB:E9Q1Q4	0.382	0.412	1.878E-19	296	0.315	0.341	E9Q1Q4.pdb.gz	E9Q1Q4_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
7	AFDB:Q99NC2	0.394	0.164	4.267E-19	804	0.333	0.133	Q99NC2.pdb.gz	Q99NC2_MOUSE MAGE-necdin/trophinin complex (Magphinin) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
8	AFDB:O15481	0.468	0.439	8.692E-19	346	0.312	0.289	O15481.pdb.gz	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
9	AFDB:Q9HAY2	0.393	0.410	9.697E-19	307	0.352	0.368	Q9HAY2.pdb.gz	MAGF1_HUMAN Melanoma-associated antigen F1 OS=Homo sapiens OX=9606 GN=MAGEF1 PE=1 SV=2
10	AFDB:Q96JG8	0.381	0.171	1.422E-18	741	0.296	0.128	Q96JG8.pdb.gz	MAGD4_HUMAN Melanoma-associated antigen D4 OS=Homo sapiens OX=9606 GN=MAGED4 PE=1 SV=3
11	PDB:7qcdE	0.322	0.387	4.446E-5	261	0.109	0.134	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
12	PDB:7tveF	0.311	0.364	2.706E-4	270	0.093	0.111	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
13	PDB:5hs7A	0.207	0.535	4.640E-2	102	0.050	0.157	5hs7A.pdb.gz
14	PDB:2nyxB	0.201	0.403	8.020E-2	147	0.059	0.129	2nyxB.pdb.gz
15	PDB:5afqB	0.181	0.138	8.020E-2	444	0.078	0.056	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
16	PDB:7d58O	0.191	0.134	8.020E-2	490	0.069	0.045	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
17	PDB:7dn3O	0.142	0.108	8.947E-2	443	0.109	0.079	7dn3O.pdb.gz	Structure of human RNA polymerase III elongation complex.
18	PDB:2xv4S	0.177	0.148	9.982E-2	399	0.062	0.050	2xv4S.pdb.gz
19	PDB:3cuqA	0.166	0.225	1.054E-1	219	0.075	0.110	3cuqA.pdb.gz
20	PDB:4zzlA	0.231	0.453	1.114E-1	146	0.065	0.144	4zzlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P25233	0.0	523	325	0.832	0.822	NECD_MOUSE Necdin OS=Mus musculus OX=10090 GN=Ndn PE=1 SV=1
2	Q99608	0.0	656	321	1.000	1.000	NECD_HUMAN Necdin OS=Homo sapiens OX=9606 GN=NDN PE=1 SV=1
3	X5D982	0.0	656	321	1.000	1.000	X5D982_HUMAN Necdin isoform A (Fragment) OS=Homo sapiens OX=9606 GN=NDN PE=2 SV=1
4	G3V7A4	3.50e-176	492	325	0.816	0.806	G3V7A4_RAT Necdin, MAGE family member OS=Rattus norvegicus OX=10116 GN=Ndn PE=4 SV=1
5	Q5PPL0	2.54e-175	490	325	0.813	0.803	Q5PPL0_RAT Necdin homolog (Mouse) OS=Rattus norvegicus OX=10116 GN=Ndn PE=2 SV=1
6	Q5H907	3.80e-58	197	521	0.296	0.182	Q5H907_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=1
7	Q5H909	1.26e-56	194	588	0.290	0.158	Q5H909_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2
8	Q9UNF1	1.68e-56	194	606	0.290	0.153	MAGD2_HUMAN Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2
9	G5E9N2	1.08e-54	191	681	0.293	0.138	G5E9N2_HUMAN Trophinin OS=Homo sapiens OX=9606 GN=TRO PE=1 SV=1
10	Q96MG7	2.37e-54	181	304	0.293	0.309	NSE3_HUMAN Non-structural maintenance of chromosomes element 3 homolog OS=Homo sapiens OX=9606 GN=NSMCE3 PE=1 SV=1
11	E9Q098	3.19e-54	191	838	0.287	0.110	E9Q098_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
12	Q99PH7	3.49e-54	191	831	0.287	0.111	Q99PH7_MOUSE Magphinin-beta 2 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
13	E9Q886	7.63e-54	191	972	0.287	0.095	E9Q886_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
14	Q99PW2	7.91e-54	191	965	0.287	0.095	Q99PW2_MOUSE Trophinin-2 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
15	Q99PM5	8.27e-54	191	906	0.287	0.102	Q99PM5_MOUSE Magphinin-alpha OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
16	E9Q1Q4	8.51e-54	179	296	0.287	0.311	E9Q1Q4_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
17	Q99NC2	2.29e-53	189	804	0.287	0.114	Q99NC2_MOUSE MAGE-necdin/trophinin complex (Magphinin) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
18	Q12816	2.54e-53	190	1431	0.293	0.066	TROP_HUMAN Trophinin OS=Homo sapiens OX=9606 GN=TRO PE=1 SV=3
19	Q9CPR8	1.73e-52	176	279	0.283	0.326	NSE3_MOUSE Non-structural maintenance of chromosomes element 3 homolog OS=Mus musculus OX=10090 GN=Nsmce3 PE=1 SV=1
20	Q80TJ5	1.77e-52	187	1736	0.287	0.053	Q80TJ5_MOUSE MKIAA1114 protein (Fragment) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01454 MAGE	2.8e-15	68.1	MAGE homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332643

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
2	9606.ENSP00000345571	0.994	Transcription factor E2F1
3	9606.ENSP00000172229	0.987	Tumor necrosis factor receptor superfamily member 16
4	9606.ENSP00000212015	0.951	NAD-dependent protein deacetylase sirtuin-1
5	9606.ENSP00000358525	0.936	Beta-nerve growth factor
6	9606.ENSP00000256637	0.934	Sortilin
7	9606.ENSP00000264657	0.912	Signal transducer and activator of transcription 3
8	9606.ENSP00000368686	0.907	Transcription factor E2F4
9	9606.ENSP00000437955	0.895	Hypoxia-inducible factor 1-alpha
10	9606.ENSP00000283179	0.882	Heterogeneous nuclear ribonucleoprotein U
11	9606.ENSP00000382972	0.835	Small nuclear ribonucleoprotein-associated protein N
12	9606.ENSP00000234198	0.827	Homeobox protein DLX-2
13	9606.ENSP00000313881	0.806	Probable E3 ubiquitin-protein ligase makorin-3
14	9606.ENSP00000369948	0.787	Solute carrier family 22 member 18
15	9606.ENSP00000431162	0.780	EP300-interacting inhibitor of differentiation 1
16	9606.ENSP00000333735	0.744	Nuclear pore-associated protein 1
17	9606.ENSP00000349325	0.726	Probable phospholipid-transporting ATPase VA
18	9606.ENSP00000232165	0.713	Ubiquitin-protein ligase E3A
19	9606.ENSP00000341680	0.702	Dysbindin
20	9606.ENSP00000355014	0.672	E3 ubiquitin-protein ligase Praja-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0080090	0.993	regulation of primary metabolic process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0051171	0.992	regulation of nitrogen compound metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.980	cellular process
GO:0051173	0.971	positive regulation of nitrogen compound metabolic process
GO:0019219	0.962	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.954	negative regulation of biological process
GO:0010604	0.921	positive regulation of macromolecule metabolic process
GO:0048523	0.861	negative regulation of cellular process
GO:0051246	0.843	regulation of protein metabolic process
GO:0032501	0.790	multicellular organismal process
GO:0050896	0.769	response to stimulus
GO:0010468	0.655	regulation of gene expression
GO:0032502	0.644	developmental process
GO:0051716	0.580	cellular response to stimulus
GO:0048522	0.566	positive regulation of cellular process
GO:0031326	0.516	regulation of cellular biosynthetic process
GO:0010556	0.499	regulation of macromolecule biosynthetic process
GO:0006355	0.487	regulation of DNA-templated transcription
GO:0023052	0.453	signaling
GO:0007154	0.447	cell communication
GO:0048856	0.438	anatomical structure development
GO:0007165	0.414	signal transduction
GO:0009892	0.389	negative regulation of metabolic process
GO:0071840	0.377	cellular component organization or biogenesis
GO:0007275	0.362	multicellular organism development
GO:0016043	0.326	cellular component organization
GO:0051247	0.321	positive regulation of protein metabolic process
GO:0031399	0.320	regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0005829	0.970	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]