StarFunc result for job id Q99615

User Input

>input (494 residues)
MAAAAECDVVMAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPK
NASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQ
RALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKI
LKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMA
PDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNR
GTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKT
KEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEV
QKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFS
FEASGPGNFFFQFG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A6I8PU73	0.959	0.953	9.325E-57	497	1.000	0.994	A0A6I8PU73.pdb.gz	A0A6I8PU73_HUMAN DnaJ heat shock protein family (Hsp40) member C7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
2	AFDB:K7ER44	0.525	0.628	1.745E-43	401	0.810	0.998	K7ER44.pdb.gz	K7ER44_HUMAN DnaJ heat shock protein family (Hsp40) member C7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2
3	AFDB:Q54IP0	0.696	0.644	1.235E-29	539	0.368	0.338	Q54IP0.pdb.gz	DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum OX=44689 GN=dnajc7 PE=1 SV=1
4	AFDB:Q9HGM9	0.615	0.636	2.848E-24	476	0.352	0.366	Q9HGM9.pdb.gz	DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC543.02c PE=4 SV=1
5	AFDB:Q38BB1	0.731	0.724	4.141E-24	499	0.298	0.295	Q38BB1.pdb.gz	Q38BB1_TRYB2 TPR-repeat-containing chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2300 PE=4 SV=1
6	AFDB:Q13217	0.440	0.433	9.760E-23	504	0.269	0.264	Q13217.pdb.gz	DNJC3_HUMAN DnaJ homolog subfamily C member 3 OS=Homo sapiens OX=9606 GN=DNAJC3 PE=1 SV=1
7	AFDB:A0A0P0VG31	0.535	0.552	1.061E-22	476	0.283	0.294	A0A0P0VG31.pdb.gz	DJC16_ORYSJ DnaJ protein P58IPK homolog A OS=Oryza sativa subsp. japonica OX=39947 GN=P58A PE=1 SV=1
8	AFDB:Q9LYW9	0.552	0.562	3.344E-21	482	0.271	0.278	Q9LYW9.pdb.gz	DNJ36_ARATH DnaJ protein P58IPK homolog OS=Arabidopsis thaliana OX=3702 GN=P58IPK PE=1 SV=1
9	AFDB:F4K0Y5	0.535	0.259	7.369E-21	1165	0.285	0.121	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
10	AFDB:P91189	0.403	0.406	1.693E-20	491	0.227	0.228	P91189.pdb.gz	P91189_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-7 PE=1 SV=1
11	PDB:2y4uA	0.359	0.413	6.634E-18	424	0.227	0.264	2y4uA.pdb.gz
12	PDB:7ntfA	0.237	0.151	3.460E-11	918	0.176	0.095	7ntfA.pdb.gz
13	PDB:7dhgC	0.275	0.285	2.156E-10	470	0.162	0.170	7dhgC.pdb.gz
14	PDB:7qdrB	0.230	0.122	4.874E-9	1212	0.162	0.066	7qdrB.pdb.gz
15	PDB:6bq1B	0.232	0.169	5.522E-9	728	0.144	0.098	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
16	PDB:6xt9D	0.232	0.266	8.368E-9	396	0.132	0.164	6xt9D.pdb.gz
17	PDB:5dseA	0.265	0.250	1.922E-8	537	0.123	0.114	5dseA.pdb.gz
18	PDB:7kw7E	0.241	0.356	2.681E-8	327	0.166	0.251	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
19	PDB:8a3tJ	0.325	0.318	4.415E-8	509	0.140	0.136	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
20	PDB:7qe7J	0.313	0.305	6.419E-8	510	0.142	0.137	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6I8PLE7	0.0	660	355	0.650	0.904	A0A6I8PLE7_HUMAN DnaJ heat shock protein family (Hsp40) member C7 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
2	A0A6I8PRZ0	0.0	902	436	0.883	1.000	A0A6I8PRZ0_HUMAN DnaJ heat shock protein family (Hsp40) member C7 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
3	A0A6I8PS32	0.0	944	467	0.929	0.983	A0A6I8PS32_HUMAN DnaJ heat shock protein family (Hsp40) member C7 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
4	A0A6I8PU73	0.0	1011	497	1.000	0.994	A0A6I8PU73_HUMAN DnaJ heat shock protein family (Hsp40) member C7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
5	A0A6I8PU89	0.0	691	347	0.680	0.968	A0A6I8PU89_HUMAN DnaJ heat shock protein family (Hsp40) member C7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
6	A0A6I8PUD4	0.0	967	481	0.949	0.975	A0A6I8PUD4_HUMAN DnaJ heat shock protein family (Hsp40) member C7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
7	K7EIH8	0.0	540	267	0.528	0.978	K7EIH8_HUMAN DnaJ heat shock protein family (Hsp40) member C7 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=9
8	K7ER44	0.0	764	401	0.812	1.000	K7ER44_HUMAN DnaJ heat shock protein family (Hsp40) member C7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2
9	Q99615	0.0	1016	494	1.000	1.000	DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2
10	K7EK03	4.24e-171	483	242	0.472	0.963	K7EK03_HUMAN DnaJ heat shock protein family (Hsp40) member C7 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=10
11	Q54IP0	5.95e-99	310	539	0.360	0.330	DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum OX=44689 GN=dnajc7 PE=1 SV=1
12	Q9HGM9	6.19e-87	276	476	0.368	0.382	DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC543.02c PE=4 SV=1
13	K7EJV7	2.60e-76	236	113	0.229	1.000	K7EJV7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
14	K7EN19	4.23e-69	218	104	0.211	1.000	K7EN19_HUMAN DnaJ heat shock protein family (Hsp40) member C7 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2
15	K7EJL5	1.38e-67	214	102	0.206	1.000	K7EJL5_HUMAN DnaJ heat shock protein family (Hsp40) member C7 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
16	Q38BB1	3.12e-61	210	499	0.316	0.313	Q38BB1_TRYB2 TPR-repeat-containing chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2300 PE=4 SV=1
17	Q9LYW9	1.41e-46	170	482	0.253	0.259	DNJ36_ARATH DnaJ protein P58IPK homolog OS=Arabidopsis thaliana OX=3702 GN=P58IPK PE=1 SV=1
18	K7EJE9	2.17e-46	157	74	0.150	1.000	K7EJE9_HUMAN DnaJ heat shock protein family (Hsp40) member C7 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
19	F4IKX0	5.39e-45	171	1108	0.302	0.134	F4IKX0_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR15 PE=1 SV=1
20	Q27968	3.55e-43	161	504	0.283	0.278	DNJC3_BOVIN DnaJ homolog subfamily C member 3 OS=Bos taurus OX=9913 GN=DNAJC3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14863 Alkyl_sulf_dimr	5.6e+02	12.3	Alkyl sulfatase dimerisation
2	PF12895 ANAPC3	0.00062	31.3	Anaphase-promoting complex, cyclosome, subunit 3
3	PF00226 DnaJ	1.7e-20	84.2	DnaJ domain
4	PF17826 DUF5588	3.3e+02	11.6	Family of unknown function (DUF5588)
5	PF05670 NFACT-R_1	3.5	19.6	NFACT protein RNA binding domain
6	PF01239 PPTA	7e+02	11.5	Protein prenyltransferase alpha subunit repeat
7	PF10579 Rapsyn_N	3.8e+02	12.6	Rapsyn N-terminal myristoylation and linker region
8	PF13446 RPT	1.8e+02	13.4	A repeated domain in UCH-protein
9	PF08238 Sel1	4.3e+02	13.0	Sel1 repeat
10	PF00515 TPR_1	3.6e-38	139.0	Tetratricopeptide repeat
11	PF13374 TPR_10	6.8	17.9	Tetratricopeptide repeat
12	PF13414 TPR_11	4.9e-14	63.0	TPR repeat
13	PF13424 TPR_12	5e-13	60.5	Tetratricopeptide repeat
14	PF13428 TPR_14	6.5e-08	43.7	Tetratricopeptide repeat
15	PF13432 TPR_16	1.3e-12	59.4	Tetratricopeptide repeat
16	PF13431 TPR_17	4.6e-12	56.5	Tetratricopeptide repeat
17	PF14559 TPR_19	3.4e-12	58.0	Tetratricopeptide repeat
18	PF07719 TPR_2	4.4e-36	131.1	Tetratricopeptide repeat
19	PF07721 TPR_4	20	17.1	Tetratricopeptide repeat
20	PF13174 TPR_6	1.4	20.8	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406463

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432083	0.991	Heat shock cognate 71 kDa protein
2	9606.ENSP00000302961	0.990	Heat shock protein family A member 4
3	9606.ENSP00000335153	0.990	Heat shock protein HSP 90-alpha
4	9606.ENSP00000364802	0.970	Heat shock 70 kDa protein 1A
5	9606.ENSP00000324173	0.953	78 kDa glucose-regulated protein
6	9606.ENSP00000297185	0.945	Stress-70 protein, mitochondrial
7	9606.ENSP00000367623	0.944	Heat shock 70 kDa protein 14
8	9606.ENSP00000364805	0.942	Heat shock 70 kDa protein 1-like
9	9606.ENSP00000296464	0.941	Heat shock 70 kDa protein 4L
10	9606.ENSP00000364801	0.941	Heat shock protein family A member 1B
11	9606.ENSP00000285667	0.938	Heat shock 70 kDa protein 13
12	9606.ENSP00000378199	0.937	Heat shock-related 70 kDa protein 2
13	9606.ENSP00000310219	0.934	Heat shock 70 kDa protein 6
14	9606.ENSP00000358211	0.930	Heat shock protein family A member 12A
15	9606.ENSP00000254963	0.926	Heat shock protein family A member 12B
16	9606.ENSP00000278483	0.906	Protein Hikeshi
17	9606.ENSP00000360609	0.773	Heat shock protein HSP 90-beta
18	9606.ENSP00000361900	0.766	Mitochondrial import receptor subunit TOM34
19	9606.ENSP00000377470	0.764	2',3'-cyclic-nucleotide 3'-phosphodiesterase
20	9606.ENSP00000482075	0.717	Prostaglandin E synthase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031072	0.999	heat shock protein binding
GO:0098772	0.996	molecular function regulator activity
GO:0060590	0.986	ATPase regulator activity
GO:0001671	0.976	ATPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.988	regulation of biological process
GO:0006457	0.964	protein folding
GO:0050794	0.935	regulation of cellular process
GO:0006458	0.922	'de novo' protein folding
GO:0061077	0.912	chaperone-mediated protein folding
GO:0051084	0.881	'de novo' post-translational protein folding
GO:0048583	0.792	regulation of response to stimulus
GO:0080134	0.626	regulation of response to stress
GO:0050896	0.412	response to stimulus
GO:0080135	0.323	regulation of cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:1903561	0.601	extracellular vesicle
GO:0070062	0.558	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]