StarFunc result for job id Q99619

User Input

>input (263 residues)
MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVK
EGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHY
AALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGY
AIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRHNLG
DTRLGQVSALPLPPAMKRYLLYQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88838	0.890	0.886	3.881E-50	264	0.909	0.905	O88838.pdb.gz	SPSB2_MOUSE SPRY domain-containing SOCS box protein 2 OS=Mus musculus OX=10090 GN=Spsb2 PE=1 SV=1
2	AFDB:Q8R5B6	0.885	0.854	9.198E-37	273	0.540	0.520	Q8R5B6.pdb.gz	SPSB4_MOUSE SPRY domain-containing SOCS box protein 4 OS=Mus musculus OX=10090 GN=Spsb4 PE=1 SV=1
3	AFDB:A1Z6E0	0.874	0.826	3.883E-34	279	0.510	0.480	A1Z6E0.pdb.gz	GUS_DROME Protein gustavus OS=Drosophila melanogaster OX=7227 GN=gus PE=1 SV=2
4	AFDB:Q96BD6	0.880	0.849	2.030E-33	273	0.498	0.480	Q96BD6.pdb.gz	SPSB1_HUMAN SPRY domain-containing SOCS box protein 1 OS=Homo sapiens OX=9606 GN=SPSB1 PE=1 SV=1
5	AFDB:P0C2W1	0.629	0.580	4.322E-23	286	0.300	0.276	P0C2W1.pdb.gz	FBSP1_HUMAN F-box/SPRY domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FBXO45 PE=1 SV=1
6	AFDB:Q9V6L9	0.622	0.640	7.221E-23	255	0.308	0.318	Q9V6L9.pdb.gz	FBSP1_DROME F-box/SPRY domain-containing protein 1 OS=Drosophila melanogaster OX=7227 GN=Fsn PE=1 SV=1
7	AFDB:Q18223	0.623	0.497	9.401E-22	332	0.270	0.214	Q18223.pdb.gz	FBSP1_CAEEL F-box/SPRY domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=fsn-1 PE=1 SV=1
8	AFDB:Q6PJ21	0.621	0.473	1.333E-16	355	0.243	0.180	Q6PJ21.pdb.gz	SPSB3_HUMAN SPRY domain-containing SOCS box protein 3 OS=Homo sapiens OX=9606 GN=SPSB3 PE=1 SV=2
9	AFDB:Q583D8	0.534	0.136	4.915E-13	1141	0.205	0.047	Q583D8.pdb.gz	Q583D8_TRYB2 SPRY domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.660 PE=4 SV=1
10	AFDB:Q8C7M3	0.515	0.177	5.832E-13	817	0.198	0.064	Q8C7M3.pdb.gz	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
11	PDB:7nscA	0.549	0.525	1.153E-11	276	0.152	0.145	7nscA.pdb.gz
12	PDB:7ccbA	0.471	0.726	1.021E-8	164	0.106	0.171	7ccbA.pdb.gz
13	PDB:7y4sA	0.465	0.365	1.358E-8	343	0.152	0.117	7y4sA.pdb.gz
14	PDB:6swy1	0.452	0.239	6.335E-8	542	0.087	0.042	6swy1.pdb.gz
15	PDB:7ua3A	0.408	0.027	1.670E-7	4443	0.095	0.006	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
16	PDB:7nsba	0.443	0.219	6.565E-7	568	0.091	0.042	7nsba.pdb.gz
17	PDB:7tzcA	0.395	0.027	7.358E-7	4404	0.099	0.006	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
18	PDB:7u9tA	0.422	0.030	7.790E-7	4229	0.099	0.006	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
19	PDB:7m6aA	0.387	0.027	1.302E-6	4306	0.099	0.006	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
20	PDB:6venO	0.489	0.414	2.302E-6	315	0.133	0.111	6venO.pdb.gz	Structural basis for COMPASS recognition of an H2B-ubiquitinated nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99619	0.0	530	263	1.000	1.000	SPSB2_HUMAN SPRY domain-containing SOCS box protein 2 OS=Homo sapiens OX=9606 GN=SPSB2 PE=1 SV=1
2	O88838	1.35e-171	475	264	0.909	0.905	SPSB2_MOUSE SPRY domain-containing SOCS box protein 2 OS=Mus musculus OX=10090 GN=Spsb2 PE=1 SV=1
3	Q96A44	1.10e-87	263	273	0.510	0.491	SPSB4_HUMAN SPRY domain-containing SOCS box protein 4 OS=Homo sapiens OX=9606 GN=SPSB4 PE=1 SV=1
4	Q9D5L7	3.06e-87	262	273	0.502	0.484	SPSB1_MOUSE SPRY domain-containing SOCS box protein 1 OS=Mus musculus OX=10090 GN=Spsb1 PE=1 SV=1
5	Q96BD6	5.88e-87	261	273	0.498	0.480	SPSB1_HUMAN SPRY domain-containing SOCS box protein 1 OS=Homo sapiens OX=9606 GN=SPSB1 PE=1 SV=1
6	Q8R5B6	1.14e-86	261	273	0.510	0.491	SPSB4_MOUSE SPRY domain-containing SOCS box protein 4 OS=Mus musculus OX=10090 GN=Spsb4 PE=1 SV=1
7	A1Z6E0	2.72e-82	250	279	0.483	0.455	GUS_DROME Protein gustavus OS=Drosophila melanogaster OX=7227 GN=gus PE=1 SV=2
8	Q8K3B1	2.02e-48	163	286	0.331	0.304	FBSP1_MOUSE F-box/SPRY domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fbxo45 PE=1 SV=2
9	P0C2W1	2.75e-48	163	286	0.331	0.304	FBSP1_HUMAN F-box/SPRY domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FBXO45 PE=1 SV=1
10	Q9V6L9	5.44e-47	159	255	0.308	0.318	FBSP1_DROME F-box/SPRY domain-containing protein 1 OS=Drosophila melanogaster OX=7227 GN=Fsn PE=1 SV=1
11	Q18223	1.61e-35	131	332	0.270	0.214	FBSP1_CAEEL F-box/SPRY domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=fsn-1 PE=1 SV=1
12	Q6PJ21	1.53e-07	53.9	355	0.205	0.152	SPSB3_HUMAN SPRY domain-containing SOCS box protein 3 OS=Homo sapiens OX=9606 GN=SPSB3 PE=1 SV=2
13	O94712	1.33e-05	48.1	491	0.167	0.090	YC5C_SCHPO Uncharacterized protein C1259.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1259.12c PE=4 SV=2
14	M9MRI4	5.25e-05	46.6	740	0.160	0.057	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
15	Q6NWY5	6.21e-05	46.2	563	0.076	0.036	Q6NWY5_DANRE Ankyrin repeat and SOCS box-containing protein 2 OS=Danio rerio OX=7955 GN=zgc:77223 PE=2 SV=1
16	Q9WV74	1.62e-04	44.7	336	0.084	0.065	ASB1_MOUSE Ankyrin repeat and SOCS box protein 1 OS=Mus musculus OX=10090 GN=Asb1 PE=2 SV=1
17	Q8C7M3	5.39e-04	43.5	817	0.118	0.038	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
18	Q91ZY8	5.43e-04	43.5	710	0.118	0.044	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
19	Q9C026	0.001	42.4	710	0.118	0.044	TRIM9_HUMAN E3 ubiquitin-protein ligase TRIM9 OS=Homo sapiens OX=9606 GN=TRIM9 PE=1 SV=1
20	Q9Y576	0.001	42.0	335	0.076	0.060	ASB1_HUMAN Ankyrin repeat and SOCS box protein 1 OS=Homo sapiens OX=9606 GN=ASB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07525 SOCS_box	5.7e-08	44.3	SOCS box
2	PF00622 SPRY	1.6e-16	71.9	SPRY domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428338

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376808	0.921	Cullin-5
2	9606.ENSP00000327251	0.909	Nitric oxide synthase, inducible
3	9606.ENSP00000478121	0.878	Elongin-C
4	9606.ENSP00000262306	0.834	Elongin-B
5	9606.ENSP00000273480	0.780	RING-box protein 2
6	9606.ENSP00000444596	0.740	E3 ubiquitin-protein ligase MYCBP2
7	9606.ENSP00000409346	0.720	Cytokine-inducible SH2-containing protein
8	9606.ENSP00000328088	0.692	PRKC apoptosis WT1 regulator protein
9	9606.ENSP00000335651	0.681	Fibronectin type III and SPRY domain containing 2
10	9606.ENSP00000353794	0.624	F-box and leucine-rich protein 22
11	9606.ENSP00000250495	0.616	NEDD8
12	9606.ENSP00000365401	0.610	Coiled-coil domain-containing protein 22
13	9606.ENSP00000263401	0.600	COMM domain-containing protein 9
14	9606.ENSP00000267935	0.600	COMM domain-containing protein 4
15	9606.ENSP00000274458	0.600	COMM domain-containing protein 10
16	9606.ENSP00000278980	0.600	COMM domain-containing protein 7
17	9606.ENSP00000308236	0.600	COMM domain-containing protein 1
18	9606.ENSP00000348054	0.600	COMM domain containing 6
19	9606.ENSP00000366032	0.600	COMM domain-containing protein 3
20	9606.ENSP00000370984	0.600	COMM domain-containing protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060090	0.772	molecular adaptor activity
GO:0030674	0.759	protein-macromolecule adaptor activity
GO:0140767	0.751	enzyme-substrate adaptor activity
GO:1990756	0.711	ubiquitin ligase-substrate adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0016567	0.993	protein ubiquitination
GO:0006511	0.954	ubiquitin-dependent protein catabolic process
GO:0050789	0.733	regulation of biological process
GO:0050794	0.465	regulation of cellular process
GO:0019222	0.351	regulation of metabolic process
GO:0060255	0.334	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043226	0.553	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]